Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate SMc01951 SMc01951 high-affinity branched-chain amino acid ABC transporter permease
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__Smeli:SMc01951 Length = 300 Score = 377 bits (967), Expect = e-109 Identities = 193/303 (63%), Positives = 242/303 (79%), Gaps = 5/303 (1%) Query: 1 MEYFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSL 60 MEYF+QQL+NGL+LG+IYG+IAIGYTMVYGIIGMINFAHG+I+M+G F ALI FL + + Sbjct: 1 MEYFVQQLVNGLTLGSIYGMIAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLLLTTF 60 Query: 61 GITWVP--LALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYV 118 I VP LALL+M+V ML A++ WT+ER+AYRPLR S RLAPLI+AIGMSI L N++ Sbjct: 61 -IAGVPVVLALLIMMVVGMLTAALWNWTIERVAYRPLRGSFRLAPLITAIGMSIVLSNFI 119 Query: 119 QILQGARSKPLQPILPGNLTLMDGAVSVSYVRLATIVITIALMYGFTQLITRTSLGRAQR 178 Q+ QG R+KP+ P++ L +SVS ++ +VIT L+ F ++ RT LGRAQR Sbjct: 120 QVTQGPRNKPIPPLVSSVYDLF--GISVSLKQIIIVVITAILLSVFWYIVNRTPLGRAQR 177 Query: 179 ACEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKAFTA 238 A EQD+KMA LLGV+VDR IS+TF+MGAALAAVAG M L+ YGV+ F GF GVKAFTA Sbjct: 178 ATEQDRKMAALLGVDVDRTISVTFIMGAALAAVAGTMYLMYYGVVVFTDGFAPGVKAFTA 237 Query: 239 AVLGGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGLLGRPEI 298 AVLGGIGSLPGA+LGG++IGLIE+ WS Y ++KDVATF+IL +VLIF+P+G+LGRPE+ Sbjct: 238 AVLGGIGSLPGAVLGGLLIGLIESLWSAYFTIDYKDVATFSILAIVLIFKPSGILGRPEV 297 Query: 299 EKV 301 EKV Sbjct: 298 EKV 300 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 300 Length adjustment: 27 Effective length of query: 274 Effective length of database: 273 Effective search space: 74802 Effective search space used: 74802 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory