Align Branched-chain amino acid ABC transporter,substrate-binding periplasmic component (characterized, see rationale)
to candidate SMa0576 SMa0576 Leu or Leu/Val/Ile transport binding protein
Query= uniprot:G8ALJ3 (366 letters) >FitnessBrowser__Smeli:SMa0576 Length = 363 Score = 377 bits (968), Expect = e-109 Identities = 180/360 (50%), Positives = 247/360 (68%) Query: 7 LLVAVAATAMTASVAKADIAVATAGPITGQYATFGEQMKKGIEQAVADINAAGGVLGQKL 66 L A A AS ++A++ + AGP++G+ A G Q+++G E AVA+INAAGGVLGQ++ Sbjct: 4 LFTAAALAFALASQSEAEVLIGVAGPMSGKLAWTGTQLRRGAEMAVANINAAGGVLGQQV 63 Query: 67 KLEVGDDACDPKQAVAVANQLAKAGVKFVAGHFCSGSSIPASQVYAEEGVLQISPASTNP 126 +L V DD CDP+QA+A A +L G FV GH+CSG+SIPAS++YA GVLQISP+STNP Sbjct: 64 RLIVADDFCDPRQALAAAEKLVADGAVFVIGHYCSGASIPASKIYAAAGVLQISPSSTNP 123 Query: 127 KLTEQNLKNVFRVCGRDDQQGQIAGKYLLENYKGKNVAILHDKSAYGKGLADETQKALNA 186 LTEQ NVFRVC RDD QG AG YL +++ +AILHD + YGKGLADET+K LN Sbjct: 124 MLTEQGHANVFRVCSRDDAQGHKAGNYLADHWGDSKIAILHDNTTYGKGLADETKKQLNM 183 Query: 187 GGQKEKIYEAYTAGEKDYSALVSKLKQEAVDVVYVGGYHTEAGLLARQMKDQGLNAPIVS 246 G E +Y++YT G+ DYS V+ L+ + V+Y+GGYHTEA L+ R +D+ ++S Sbjct: 184 RGVTEAVYQSYTPGKDDYSVEVAALQTAHIAVLYLGGYHTEAALMVRAARDRAYPVQLIS 243 Query: 247 GDALVTNEYWAITGPAGENTMMTFGPDPREMPEAKEAVEKFRKAGYEPEGYTLYTYAALQ 306 GD T + I GPA E T+ TF DPR EA E VE+FR +EP+ +TL++Y A + Sbjct: 244 GDDTATEAFGLIAGPAAEGTLFTFVADPRRNAEAAEVVERFRAENFEPDSWTLHSYGAAE 303 Query: 307 IWAEAAKQANSTDSAKIADVLRKNSYNTVIGKIGFDAKGDVTSPAYVWYRWNNGQYAQVK 366 IWA+A +ANS D + LR++ ++TV+G+I FD KGD+T ++VWY W +G+Y V+ Sbjct: 304 IWAQAVTKANSLDLQAVIAALREDQFDTVLGRIDFDKKGDLTVQSWVWYVWKSGEYVPVE 363 Lambda K H 0.312 0.129 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 363 Length adjustment: 29 Effective length of query: 337 Effective length of database: 334 Effective search space: 112558 Effective search space used: 112558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory