Align Branched-chain amino acid ABC transporter,substrate-binding periplasmic component (characterized, see rationale)
to candidate SMc01946 SMc01946 leucine-specific binding protein
Query= uniprot:G8ALJ3 (366 letters) >FitnessBrowser__Smeli:SMc01946 Length = 372 Score = 424 bits (1090), Expect = e-123 Identities = 206/360 (57%), Positives = 262/360 (72%), Gaps = 3/360 (0%) Query: 4 KLSLLVAVAATAMTA--SVAKADIAVATAGPITGQYATFGEQMKKGIEQAVADINAAGGV 61 K SLL AVA TAM A A ADI V GP+TG A FG Q++KG EQA DINAAGG+ Sbjct: 2 KKSLLSAVALTAMVAFSGTAWADILVGVGGPLTGPNAAFGAQLQKGAEQAAEDINAAGGI 61 Query: 62 LGQKLKLEVGDDACDPKQAVAVANQLAKAGVKFVAGHFCSGSSIPASQVYAEEGVLQISP 121 G+++K+ +GDD DPKQ V+VA + GVKFV GHF SG SIPAS++YAE G+LQ++P Sbjct: 62 NGEQIKVVLGDDVSDPKQGVSVAQKFVADGVKFVVGHFNSGVSIPASEIYAENGILQVTP 121 Query: 122 ASTNPKLTEQNLKNVFRVCGRDDQQGQIAGKYLLENYKGKNVAILHDKSAYGKGLADETQ 181 ASTNP+ TE+ L N FR CGRDDQQG +AG Y+ N+K VA++HDK+ YG+GLADET+ Sbjct: 122 ASTNPQFTERGLWNTFRTCGRDDQQGAVAGAYIAANFKDAKVAVIHDKTPYGQGLADETK 181 Query: 182 KALNAGGQKEKIYEAYTAGEKDYSALVSKLKQEAVDVVYVGGYHTEAGLLARQMKDQGLN 241 K++N G E +YE G+KD+SAL++K+KQ V +VY GG HTEAGL+ RQMKDQGL Sbjct: 182 KSMNEAGVTEALYEGINTGDKDFSALIAKMKQAGVSIVYYGGLHTEAGLIMRQMKDQGLK 241 Query: 242 APIVSGDALVTNEYWAITGPAGENTMMTFGPDPREMPEAKEAVEKFRKAGYEPEGYTLYT 301 A ++SGD +V+NE +I G A + T+MTF PDPR+ P AK+ VEKFR AG+EPE YTLY Sbjct: 242 ATMMSGDGIVSNELASIAGDAVDGTLMTFAPDPRKSPAAKDLVEKFRAAGFEPEAYTLYA 301 Query: 302 YAALQIWAEAAKQANSTDSAKIADVLR-KNSYNTVIGKIGFDAKGDVTSPAYVWYRWNNG 360 YAALQ+ AE AK A +TD +A+ ++ K + T IG++GFD KGD+T P YV Y W G Sbjct: 302 YAALQVIAEGAKAAGNTDPQAVAEAIKAKGPFKTAIGELGFDEKGDITRPDYVMYTWKKG 361 Lambda K H 0.312 0.129 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 372 Length adjustment: 30 Effective length of query: 336 Effective length of database: 342 Effective search space: 114912 Effective search space used: 114912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory