Align ABC-type branched-chain amino acid transport system, periplasmic component protein (characterized, see rationale)
to candidate SMc01946 SMc01946 leucine-specific binding protein
Query= uniprot:D8IUY1 (378 letters) >FitnessBrowser__Smeli:SMc01946 Length = 372 Score = 197 bits (500), Expect = 5e-55 Identities = 129/367 (35%), Positives = 187/367 (50%), Gaps = 21/367 (5%) Query: 12 AASLALIPAFAMAQETQVVKIGFSSPLTGPQASAGKDNQGGLMMAIERLNAQPITVGGKK 71 A +L + AF+ ++ +G PLTGP A+ G Q G A E +NA + G++ Sbjct: 8 AVALTAMVAFSGTAWADIL-VGVGGPLTGPNAAFGAQLQKGAEQAAEDINAAG-GINGEQ 65 Query: 72 IKFDVIAEDDQADPKSGVAVAQKLADQGVKAIVGPYNSGVTIPASRVYNDAGIVVATVAS 131 IK V+ DD +DPK GV+VAQK GVK +VG +NSGV+IPAS +Y + GI+ T AS Sbjct: 66 IK--VVLGDDVSDPKQGVSVAQKFVADGVKFVVGHFNSGVSIPASEIYAENGILQVTPAS 123 Query: 132 -NPKITQQGFATLFRVAASDSQLGGKMALYAAKELKFKRVAVIDDRTAYGQGLAQEFIKV 190 NP+ T++G FR D Q G Y A K +VAVI D+T YGQGLA E K Sbjct: 124 TNPQFTERGLWNTFRTCGRDDQQGAVAGAYIAANFKDAKVAVIHDKTPYGQGLADETKKS 183 Query: 191 AKANGIDVVSTDFTNDKATDFTAILTSIKGKKPDAVFLGGYAPQGGPIKRQMKQLGVDVP 250 G+ + N DF+A++ +K V+ GG + G I RQMK G+ Sbjct: 184 MNEAGVTEALYEGINTGDKDFSALIAKMKQAGVSIVYYGGLHTEAGLIMRQMKDQGLKAT 243 Query: 251 LMGGDGICSPEMGRLGGDAIGESVYCTQGGTMLD------KAKEGKVFSDEYQKKYNRPA 304 +M GDGI S E+ + GDA+ GT++ K+ K ++++ P Sbjct: 244 MMSGDGIVSNELASIAGDAV--------DGTLMTFAPDPRKSPAAKDLVEKFRAAGFEP- 294 Query: 305 ETYAVSFYDGMMLIAQAMKQANSVDPKQFGPAL-AKISYKGVAGQYDFDANHDLKQSPVT 363 E Y + Y + +IA+ K A + DP+ A+ AK +K G+ FD D+ + Sbjct: 295 EAYTLYAYAALQVIAEGAKAAGNTDPQAVAEAIKAKGPFKTAIGELGFDEKGDITRPDYV 354 Query: 364 VYRFKDG 370 +Y +K G Sbjct: 355 MYTWKKG 361 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 372 Length adjustment: 30 Effective length of query: 348 Effective length of database: 342 Effective search space: 119016 Effective search space used: 119016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory