Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate SMa0217 SMa0217 ABC transporter permease
Query= uniprot:D8IUY5 (404 letters) >FitnessBrowser__Smeli:SMa0217 Length = 359 Score = 63.9 bits (154), Expect = 7e-15 Identities = 67/220 (30%), Positives = 95/220 (43%), Gaps = 30/220 (13%) Query: 123 LSLWLIVPISAFLAALFGALLGAPTLKLRGDYLAIVTLGFGEIIRIFMNNLNAPVNITNG 182 LS ++ PI+ L G+L G TL+ G IVTLG R + N V + Sbjct: 131 LSAFIAAPIAILTGLLIGSLNGHITLRF-GLPSFIVTLGGLLFWRGAVLLYNGAVQVR-- 187 Query: 183 PQGINLIDPIKVFGVSLAGEPGSGSMVKVFGMSMPSVNAYYFLFLLLCIGVIFFSVRLQD 242 DP VF +F ++ VNA + +L G F + L Sbjct: 188 ------FDPEPVF-------------TSLFSGTLFGVNAAFIWIVLFVTG---FHLLLHR 225 Query: 243 SRLGRAWVAIREDEIAAKAMGINTRNVKLLAFAMGASFGGVAGAMFGAFQGFVSPESFSL 302 R G A + AA+A+GINT VKL+AFA+ VAG + A G V P + Sbjct: 226 HRFGNHVFATGGNRGAAEAIGINTSRVKLIAFAIAGGMAAVAGILATARVGSVQPGQGAG 285 Query: 303 TESIAVLAMVV-----LGGIGHIPGVVLGGVILAALPEVL 337 E A+ A V+ GG G I G+ LG +++ + +VL Sbjct: 286 LELQAIAACVIGGLSLRGGRGSIIGIFLGVLLIHTITDVL 325 Lambda K H 0.327 0.143 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 359 Length adjustment: 30 Effective length of query: 374 Effective length of database: 329 Effective search space: 123046 Effective search space used: 123046 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory