GapMind for catabolism of small carbon sources

 

Aligments for a candidate for davD in Sinorhizobium meliloti 1021

Align Glutarate-semialdehyde dehydrogenase (EC 1.2.1.20) (characterized)
to candidate SM_b21185 SM_b21185 succinate-semialdehyde dehydrogenase (NAD(P)+) protein

Query= reanno::pseudo13_GW456_L13:PfGW456L13_495
         (480 letters)



>lcl|FitnessBrowser__Smeli:SM_b21185 SM_b21185
           succinate-semialdehyde dehydrogenase (NAD(P)+) protein
          Length = 491

 Score =  561 bits (1446), Expect = e-164
 Identities = 267/458 (58%), Positives = 352/458 (76%), Gaps = 3/458 (0%)

Query: 25  GQTIKVNNPATGEILGTVPKMGAAETRRAIEAADKALPAWRALTAKERATKLRRWYELII 84
           G    V+NP+TGE+L T+P MG  + R AI+AA  A P W    AK+R+  LRRW++LI+
Sbjct: 32  GPVFDVSNPSTGELLATLPDMGIDDARTAIDAAALAQPLWAGKPAKDRSIILRRWHDLIV 91

Query: 85  ENQDDLARLMTLEQGKPLAEAKGEIVYAASFIEWFAEEAKRIYGDVIPGHQPDKRLIVIK 144
           E+ DDLA ++T E GKP+ EAKGE+++AAS++EW+AEEAKR+YG+  P    D+R++VIK
Sbjct: 92  EHADDLAAILTAEMGKPVGEAKGEVLHAASYVEWYAEEAKRVYGETFPAPANDRRMLVIK 151

Query: 145 QPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKPASQTPFSAFALAELAQRAGIPAG 204
           QP+GV   ITPWNFPA+M+ RK  PALAAGCT+VLKPA QTP  A A+  LA++AG P G
Sbjct: 152 QPVGVVGTITPWNFPASMVARKISPALAAGCTIVLKPAEQTPLVAGAMFVLAEKAGFPEG 211

Query: 205 VFSVVSGSAG-DIGSELTSNPIVRKLSFTGSTEIGRQLMSECAKDIKKVSLELGGNAPFI 263
           V +++  S G  IG EL  NP VRK+SFTGSTE+GR LM +C+  IKKVSLELGGNAPFI
Sbjct: 212 VLNLLYASEGAPIGRELCGNPKVRKISFTGSTEVGRLLMRQCSDQIKKVSLELGGNAPFI 271

Query: 264 VFDDADLDKAVEGAIISKYRNNGQTCVCANRLYIQDGVYDAFAEKLKVAVAKLKIGNGLE 323
           VFDDAD+D+AV+GA+ +K+RN GQTCV ANR+Y+Q  V+DAFAEK    V +L +G+G  
Sbjct: 272 VFDDADIDEAVDGAVQAKFRNAGQTCVSANRIYVQSAVHDAFAEKFVTRVRELTVGDGFA 331

Query: 324 AGTTTGPLIDEKAVAKVQEHIADALSKGATVLAGGKPM--EGNFFEPTILTNVPNNAAVA 381
                GP+ID  A+ K++ H+ADA++KGA V +GG  +   G FFEPT+LT + ++  +A
Sbjct: 332 PDVAIGPMIDAHAIDKIEAHVADAVAKGAQVRSGGSRIGTTGTFFEPTVLTGISHDMRIA 391

Query: 382 KEETFGPLAPLFRFKDEADVIAMSNDTEFGLASYFYARDLGRVFRVAEALEYGMVGVNTG 441
           +EETFGP+AP+ RF+    V+A +NDT +GLA+YFYA +L RV+ VAEALEYGMVG+NTG
Sbjct: 392 QEETFGPIAPIIRFETAEQVVAEANDTIYGLAAYFYAENLKRVWHVAEALEYGMVGINTG 451

Query: 442 LISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYLCLG 479
            +S+E APFGGIK SG+GREGS++G+EDYLE+KYLC+G
Sbjct: 452 RMSSEAAPFGGIKQSGIGREGSRHGLEDYLEMKYLCMG 489


Lambda     K      H
   0.317    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 671
Number of extensions: 25
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 480
Length of database: 491
Length adjustment: 34
Effective length of query: 446
Effective length of database: 457
Effective search space:   203822
Effective search space used:   203822
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory