Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate SM_b21146 SM_b21146 choline uptake ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__Smeli:SM_b21146 Length = 312 Score = 182 bits (463), Expect = 6e-51 Identities = 101/242 (41%), Positives = 147/242 (60%), Gaps = 7/242 (2%) Query: 32 DILSRSGCTVGLNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNI 91 +I R G T ++DVSL + + V++G SGSGK+TL+R INRL+EPT+G + DG++ Sbjct: 6 EISKRYGDTTVVSDVSLTVAPHTVTVVVGTSGSGKTTLLRMINRLVEPTAGTIKIDGEDN 65 Query: 92 LDLGAKALRAFRMRRVSMVFQSFALMPHRTVLQNVVYGQRVRGVSKD--DAREIGMKWID 149 + LR RR+ Q L PHRTV QN+ + G K DA+ + + Sbjct: 66 RSIPGFELR----RRIGYAIQGHGLFPHRTVAQNIATVPTLLGWEKARIDAKVEELLKLF 121 Query: 150 TVGLSGYDAKFPHQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQL 209 + S + ++PH+LSGG +QRVG+ARALAA+ +V+LMDE F ALDP+IR QD L + Sbjct: 122 QLDPSEFGPRYPHELSGGQQQRVGVARALAAEPNVLLMDEPFGALDPIIRAKAQDDLAAI 181 Query: 210 QRNLAKTIVFITHDLDEALRIGSEIAILRDGQVVQVGTPNDILDNPANDYVARFVQRRHE 269 Q++ TI+ +THD++EA + IA++ G+VVQ TP ++L PA +V V E Sbjct: 182 QKHFGTTIILVTHDMEEAFHLADRIAVMDKGEVVQYATPAEMLVRPATPFVETLV-GASE 240 Query: 270 RP 271 RP Sbjct: 241 RP 242 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 312 Length adjustment: 26 Effective length of query: 249 Effective length of database: 286 Effective search space: 71214 Effective search space used: 71214 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory