Align proline porter II (characterized)
to candidate SMc01869 SMc01869 transport transmembrane protein
Query= CharProtDB::CH_024324 (500 letters) >FitnessBrowser__Smeli:SMc01869 Length = 436 Score = 257 bits (657), Expect = 5e-73 Identities = 143/411 (34%), Positives = 236/411 (57%), Gaps = 13/411 (3%) Query: 25 KAITAASLGNAMEWFDFGVYGFVAYAL-GKVFFPGADPSVQMVAALATFSVPFLIRPLGG 83 + + A+ +G +E+FDF VY A + +FFP ADP+ M+ +LATFS+ F RPLG Sbjct: 25 RVLFASLVGTTIEFFDFYVYATAAVIIFPHLFFPAADPTSAMLQSLATFSIAFFARPLGA 84 Query: 84 LFFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYDTIGIWAPILLLICKMAQGFSVGG 143 + FG GD+ GR+ L ++ M IST IGL+P+Y TIG+ AP+LL +C+ QG +GG Sbjct: 85 VIFGHFGDRIGRKATLVAALMTMGISTVVIGLLPTYSTIGVVAPLLLALCRFGQGLGLGG 144 Query: 144 EYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGAGVVVLISTIVGEANFLDWGWRIP 203 E+ GA + E +P+ KR + + G+ GF+L AG +++ ++ E FL WGWR+P Sbjct: 145 EWGGAVLLATENAPEGKRSWYAMFPQLGAPIGFILSAGTFLILGEVMSEEAFLAWGWRVP 204 Query: 204 FFIALPLGIIGLYLRHALEETPAFQQHVDKLEQGDREGLQDGPKVSFKEIATKYWRSLLT 263 F ++ L I+GLY+R + ETP FQ+ +DK E+ +V I + RSL+ Sbjct: 205 FIASVLLVIVGLYVRLKITETPEFQKAIDKHER---------VEVPVAAIFRSHKRSLVL 255 Query: 264 CIGLVIATNVTYYMLLTYMPSYLSHNLHYSEDHGVLIIIAIMIGMLFVQPVMGLLSDRFG 323 + +AT V +Y++ + S+ + L YS + +L+ + ++ + PV G+LSDRFG Sbjct: 256 GTFVALATFVLFYLMTVFSLSWGTTKLGYSREQFLLVQMTGVVFFGLMIPVSGILSDRFG 315 Query: 324 RRPFVLLGSVALFVLAIPAFILINSNVIGLIFAGLLMLAVILNCFTGVMASTLPAMFPTH 383 RR ++L ++ + V + L++S + G ++ L ++ G + + L A FPT Sbjct: 316 RRLVLVLTTIGIGVFGLFMAPLLSSGLGGAFVFSIVGLG-LMGLTYGPIGAALAAPFPTA 374 Query: 384 IRYSALAAAFNIS-VLVAGLTPTLAAWLVESSQNLMMPAYYLMVVAVVGLI 433 +RY+ + FN++ + A L P +A WL ++ +L YYL+ A + L+ Sbjct: 375 VRYTGASMTFNLAGIFGASLAPYIATWLA-TNYSLGHVGYYLLAAASITLV 424 Lambda K H 0.327 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 653 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 500 Length of database: 436 Length adjustment: 33 Effective length of query: 467 Effective length of database: 403 Effective search space: 188201 Effective search space used: 188201 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory