Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate SMa1466 SMa1466 ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >FitnessBrowser__Smeli:SMa1466 Length = 371 Score = 190 bits (482), Expect = 7e-53 Identities = 121/360 (33%), Positives = 201/360 (55%), Gaps = 22/360 (6%) Query: 42 LGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELR 101 + V + SL + GEI V++G SG GK+T ++++NRLI+PT G+V I+G D + I +LR Sbjct: 19 IAVDNVSLDLPTGEICVLLGPSGCGKTTTMKMINRLIQPTSGKVFINGKDTSTIDPIKLR 78 Query: 102 EVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLEN--YAH 159 + I V Q L P+ TV +N +L G ++ R +A + L VGL+ + Sbjct: 79 ----RTIGYVIQQIGLFPNKTVEENICVVPDLLGWDRRKSRARAKELLELVGLQPDLFLK 134 Query: 160 AYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIV 219 YP ELSGG +QRVG+ RALA +P ++LMDE F A+DP+ R +Q+E +K+Q + ++TI+ Sbjct: 135 RYPKELSGGQQQRVGVLRALAADPPVMLMDEPFGAIDPINREAIQEEFLKMQREIRKTII 194 Query: 220 FISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFF---RGVDISQVFSA 276 F+SHDLDEA+++ D+IAI ++G + Q PDE+L PAN ++ F R + ++ S Sbjct: 195 FVSHDLDEAVKMADKIAIFRSGRLEQYAAPDELLARPANSFIEDFLGSDRALKRLRLVSV 254 Query: 277 KDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKFVGVVS--IDSLKAAL- 333 +D G I AL+ ++ +V+ ++S + L++ Sbjct: 255 RDAME---TGFITVRSSDSVEHALERMRSSRSAAVFVLNADGAPQSLLSEQVAELRSGTV 311 Query: 334 -SQAQGIEAALIDDPLVVDAQTPLSELLSHVGQAPCAVPVVDEEHQYVGIISKRMLLQAL 392 A+ +++A+ P D + +S + +H P +P VDE + G++S R ++ L Sbjct: 312 GDHAEPVKSAV---PTTGDLRQAVSIMFAH--DMP-LLPCVDEGGRMAGVMSYRSIVHYL 365 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 371 Length adjustment: 30 Effective length of query: 370 Effective length of database: 341 Effective search space: 126170 Effective search space used: 126170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory