Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate SMc02379 SMc02379 permease
Query= SwissProt::P14176 (354 letters) >FitnessBrowser__Smeli:SMc02379 Length = 295 Score = 222 bits (566), Expect = 8e-63 Identities = 123/293 (41%), Positives = 178/293 (60%), Gaps = 11/293 (3%) Query: 38 DWLTSTPAPNVEHFNILDPFHKTLIPLDSWVTEGIDWVVTHFRPVFQGVRVPVDYILNGF 97 +WLT P + + L L + EG + + P+ + L Sbjct: 2 EWLTKFPHMDDDR----------LRQLKKIIDEGFRSFTRAYGDAIESFFDPLQFFLIHA 51 Query: 98 QQLLLGMPAPVAIIVFALIAWQISGVGMGVATLV-SLIAIGAIGAWSQAMVTLALVLTAL 156 ++ + P P+ +I+ A+IAW S VA + +L+ IG + W M T++++ Sbjct: 52 ERFMTRTPWPIILILIAVIAWFASRNWKIVAGAIGTLLLIGYLDMWDDTMKTISMIFVCT 111 Query: 157 LFCIVIGLPLGIWLARSPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTII 216 + I IG+P+GI ++RS R I+ P+LD MQT P+FVYL+P+VML GIG VPG++ +I Sbjct: 112 VLSIAIGIPMGIIMSRSDRFQNIVNPVLDVMQTMPSFVYLIPVVMLLGIGKVPGLIAVVI 171 Query: 217 FALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLAL 276 +A+PP+IRLT LGI V D++EA+ +FG+S Q L VQ+PLA+PTIMAG+NQT+M+AL Sbjct: 172 YAIPPMIRLTNLGIRLVDKDVLEAADAFGSSNWQKLKNVQMPLALPTIMAGINQTIMMAL 231 Query: 277 SMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGGVGIVILAIILDRLTQAVGR 329 +MVVIASMI V GLGQ VL+ I L G+ IV +AII DR++QA GR Sbjct: 232 AMVVIASMIGVQGLGQPVLKAIANQYFTLGIFNGLAIVGIAIIFDRVSQAYGR 284 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 295 Length adjustment: 28 Effective length of query: 326 Effective length of database: 267 Effective search space: 87042 Effective search space used: 87042 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory