Align 2-methylcitrate synthase (EC 2.3.3.5) (characterized)
to candidate SMc02087 SMc02087 type II citrate synthase
Query= reanno::pseudo6_N2E2:Pf6N2E2_6062 (375 letters) >FitnessBrowser__Smeli:SMc02087 Length = 429 Score = 181 bits (458), Expect = 4e-50 Identities = 123/372 (33%), Positives = 183/372 (49%), Gaps = 37/372 (9%) Query: 32 LTYRGYDVRDLAADAQFEEVAYLLLYGELPTQAQLDAYTGKLRQLRDLPQALKEVLERIP 91 L +RG+ + LA F EV YLLLYGELPT+AQ + ++ + + + Sbjct: 67 LLHRGFPIEQLAEHGDFLEVCYLLLYGELPTKAQKADFDYRVTHHTMVHEQMSRFFTGFR 126 Query: 92 ADAHPMDVMRTGCSFLGNLEPEQDFSQQHDKTD------------RLLAAFPAIMCYWYR 139 DAHPM VM C +G L + HD TD R++A P I Y+ Sbjct: 127 RDAHPMAVM---CGCVGALS-----AFYHDSTDITDPHQRMVASLRMIAKMPTIAAMAYK 178 Query: 140 FSHQGQRIECVTDEVSIGGHFLHLLHGKKPSELHV-----KVMNVSLILYAEHEFNASTF 194 + H GQ +++ +FL + E V + M+ IL+A+HE NAST Sbjct: 179 Y-HIGQPFVYPKNDLDYASNFLRMCFAVPCEEYVVNPVLARAMDRIFILHADHEQNASTS 237 Query: 195 TARVCASTLSDLFSCITAAIGSLRGPLHGGANEAAMEMIERFSSPQEAIEGTLGMLARKD 254 T R+ S+ ++ F+CI A I L GP HGGANEAA+ M+ + E + D Sbjct: 238 TVRLAGSSGANPFACIAAGIACLWGPAHGGANEAALNMLAEIGTVDRIPEYITKAKDKND 297 Query: 255 --KIMGFGHAIYKDNDPRNEVIKGWSKKLADEVG--DTVLFPVSEAIDK-----TMWEQK 305 ++MGFGH +YK+ DPR ++++ + ++ E+G D L V+ +++ + +K Sbjct: 298 PFRLMGFGHRVYKNYDPRAKIMQKTTHEVLAELGHKDDPLLEVAMELERIALTDEYFIEK 357 Query: 306 KLFPNADFYHASAYHFMGIPTKLFTPIFVCSRLTGWAAHVFE--QRANNRIIRPSAEYTG 363 KL+PN DFY +G PT +FT +F +R GW A E + RI RP Y G Sbjct: 358 KLYPNIDFYSGITLKALGFPTTMFTVLFALARTVGWIAQWNEMIEDPEQRIGRPRQLYVG 417 Query: 364 VEQRKFVPIEQR 375 R +VPI +R Sbjct: 418 APLRDYVPISKR 429 Lambda K H 0.321 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 36 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 429 Length adjustment: 31 Effective length of query: 344 Effective length of database: 398 Effective search space: 136912 Effective search space used: 136912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory