Align Acyl-coenzyme A synthetase ACSM3, mitochondrial; Acyl-CoA synthetase medium-chain family member 3; Butyrate--CoA ligase 3; Butyryl-coenzyme A synthetase 3; Middle-chain acyl-CoA synthetase 3; Propionate--CoA ligase; Protein SA homolog; EC 6.2.1.2; EC 6.2.1.17 (characterized)
to candidate SMc00741 SMc00741 fatty-acid-CoA ligase
Query= SwissProt::Q3UNX5 (580 letters) >FitnessBrowser__Smeli:SMc00741 Length = 548 Score = 249 bits (637), Expect = 2e-70 Identities = 168/548 (30%), Positives = 269/548 (49%), Gaps = 25/548 (4%) Query: 36 NYESMKQDFKIEIPEYFNFAKDVLDQWTNMEKAGKRLSNPAFWWIDGNGEELRWSFEELG 95 +Y+ + ++F+ IPE FN V D W + L + +G L ++ + Sbjct: 7 DYDELYREFRWRIPERFNIGVAVSDAWAARDPERICLQH-----FSPDGAHLALTYGDFA 61 Query: 96 LLSRKFANILTEACSLQRGDRVMVILPKIPEWWLANVACLRTGTVLIPGTTQLTQKDILY 155 S FA L A + G+RV ++LP+ E +A+ A + G + +P + + Y Sbjct: 62 ARSSAFAGGLA-AHDVSPGERVAILLPQGFEAAIAHAAIYKLGAIALPLALLFGVEALAY 120 Query: 156 RLQSSKAKCIITDDTLAPAVDAVAAKCENLHSKLIVSQHSREGWGNLKEMMKYASDSHTC 215 RL+ + A ++T+ + A+ + L ++ + + G +++ Sbjct: 121 RLKDAGAAAVVTNRFGYERLAAIRGELPELRMVVLAEEDEKPGTVRFRDIAA-GQGRFDP 179 Query: 216 VDTKHDEMMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNGRFWLDLIAS--DVMWNTSDTG 273 +TK D+ + +TSGTTGPPK H H LG +F + D MW +D Sbjct: 180 AETKPDDPALMIYTSGTTGPPKGALHGHRVL-LGHLPGFQFHHHFLPQPGDRMWTPADWA 238 Query: 274 WAKSAWSSVFSPWTQGACVFAHYLPRFESTSILQTLSKFPITVFCSAPTAYRMLVQ---- 329 WA +++ G V + +F++ + + + + + PTA R+L Sbjct: 239 WAGGLLNALLPSLFFGVPVVSSPAQKFDAHTAFRIIEEMEVRNAFIPPTALRLLKSVERP 298 Query: 330 NDMSSYKFNSLKHCVSAGEPINPEVMEQWRKKTGLDIYEGYGQTETVLICGNFKGMKI-K 388 D + K ++ SAGE + E E R G+++ E YGQTE ++ + G+ + K Sbjct: 299 RDRCALKLRTVG---SAGEALGRETFEWARAALGVEVSEFYGQTECNIVISSATGLGVAK 355 Query: 389 PGSMGKPSPAFDVKILDENGATLPPGQEGDIALQVLPERPFG-LFTHYVDNPSKTASTLR 447 GSMGK +P V I+D G LPPG G +A++ RP +F Y N T + Sbjct: 356 AGSMGKAAPGHQVAIIDGEGRVLPPGTVGQVAIR----RPDPVMFLGYWRNEEATEAKFI 411 Query: 448 GSFYITGDRGYMDEDGYFWFVARSDDIILSSGYRIGPFEVESALIEHPSIAESAVVSSPD 507 G + TGD+G MDE+GYF F R DD+I SSGYRIGP E+E L HP + +A V PD Sbjct: 412 GDWMTTGDQGVMDEEGYFTFFGRDDDVITSSGYRIGPSEIEDCLAGHPDVQLAAAVGKPD 471 Query: 508 PIRGEVVKAFIVLNPDYKSHDQEQLKKEIQEHVKKTTAPYKYPRKVEFIEELPKTVSGKV 567 P+R E+VKA++VL P + D + I++ VK + ++YPR++ F++ LP T SGKV Sbjct: 472 PLRTEIVKAYVVLKPGVAAGD--ETAAGIRDWVKNRLSMHEYPREIAFVDSLPLTTSGKV 529 Query: 568 KRNELRKK 575 R LR+K Sbjct: 530 IRRLLREK 537 Lambda K H 0.319 0.134 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 797 Number of extensions: 42 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 580 Length of database: 548 Length adjustment: 36 Effective length of query: 544 Effective length of database: 512 Effective search space: 278528 Effective search space used: 278528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory