Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate SM_b20281 SM_b20281 spermidine/putrescine ABC transporter ATP-binding protein
Query= CharProtDB::CH_024626 (378 letters) >FitnessBrowser__Smeli:SM_b20281 Length = 356 Score = 284 bits (726), Expect = 3e-81 Identities = 168/364 (46%), Positives = 217/364 (59%), Gaps = 11/364 (3%) Query: 14 LSPLVQLAGIRKCFDGKEVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGR 73 + P+V + K + G + LDL + +G+F+TLLGPSGCGK+T LR++ G E SG Sbjct: 1 MQPVVHFKNVNKYYGGLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGE 60 Query: 74 IMLDNEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALR 133 I L+ + ITH+P R VN VFQ YALFPH+ V N+AFGL ++ + I R ME L Sbjct: 61 IYLEGKPITHLPPNRRNVNIVFQDYALFPHLNVGRNIAFGLELKGLSSDAIHKRTMELLA 120 Query: 134 MVQLETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKAL 193 +V+L+ FA R P QLSGGQ+QRVA+ RA+ P +LLLDE LSALD KLR+QMQ ELK + Sbjct: 121 LVKLQDFADRMPDQLSGGQRQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTI 180 Query: 194 QRKLGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINM 253 QR G TF+FVTHDQEEALTMSD IVVM GRIEQ G P E+Y P++ FVA FIG+ N Sbjct: 181 QRTTGKTFIFVTHDQEEALTMSDVIVVMNKGRIEQMGGPNELYSRPRSRFVANFIGQSNF 240 Query: 254 FNATVIERLDEQRVRANVEGRECNIYVNFAVEP-GQKLHVLLRPEDLR-VEEINDDNHAE 311 ++ D + G + +N P G V LRPE L + E D A Sbjct: 241 LEGKLLSH-DGTTAAIDWNGSIIHADLNGTKLPAGSGATVALRPEALYCMAEQPKDRFA- 298 Query: 312 GLIGYVRERNYKGMTLESVVELENGKMVMVSEFFNEDDP-DFDHSLDQKMAINWVESWEV 370 L G + +R +KG +ELENG +E + DP H ++ + W E V Sbjct: 299 -LRGRIVQRVFKGAHTSLTIELENG-----AELALQLDPVALSHLERDEVWVGWRERDAV 352 Query: 371 VLAD 374 VLAD Sbjct: 353 VLAD 356 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 356 Length adjustment: 30 Effective length of query: 348 Effective length of database: 326 Effective search space: 113448 Effective search space used: 113448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory