Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate SMa1754 SMa1754 ABC transporter ATP-binding protein
Query= TCDB::P31134 (377 letters) >FitnessBrowser__Smeli:SMa1754 Length = 359 Score = 276 bits (707), Expect = 5e-79 Identities = 151/361 (41%), Positives = 224/361 (62%), Gaps = 7/361 (1%) Query: 15 ALTPLLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAG 74 ++ ++ +TK Y V+++ L I +GE +LLG SG GK+TLL MLAGFEQP++G Sbjct: 4 SVAEFIQFDRITKFYGPLCVVENLVLGIGQGEFVSLLGPSGSGKTTLLMMLAGFEQPTSG 63 Query: 75 QIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEML 134 I+LDG ++ VP + R + ++FQSYALFPHM+V +N+AF L+ L KAEIA V L Sbjct: 64 NILLDGTAINDVPTHKRDMGVVFQSYALFPHMSVGENVAFPLQMRGLGKAEIAECVARAL 123 Query: 135 GLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVD 194 +V + FA R+P QLSGGQ+QRVAL+R+L P+++L+DEP+GALDK+LR++MQ ++ D Sbjct: 124 DMVQLSAFADRRPSQLSGGQQQRVALSRALVFEPRVVLMDEPLGALDKQLREQMQFDIRD 183 Query: 195 ILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVN 254 + R+G+T V VTHDQ EA+TM+ R+A+ NRGK QIG P ++Y+ P TR+ AEFIG N Sbjct: 184 LHRRLGLTIVFVTHDQSEALTMSDRVAVFNRGKIEQIGTPRQVYDEPATRFVAEFIGETN 243 Query: 255 VFEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEEPPANGCN 314 + EGV++ Q ++ P H + S+V V +++RPE++ L E + N Sbjct: 244 LVEGVVETVQGQEAIVRLPSGAHIVSA-GSGSLVSGQSVFLSIRPERVDL-SETRGDARN 301 Query: 315 FAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTWGDEVRLCWEVDSCVV 374 EV Y GD H+R++ + R + P G +V + + C V Sbjct: 302 CLETEVTDSVYQGD----HLRVQLQSAAHPLIAKLGRRSREFPP-GTKVYAAFSANDCRV 356 Query: 375 L 375 + Sbjct: 357 I 357 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 359 Length adjustment: 30 Effective length of query: 347 Effective length of database: 329 Effective search space: 114163 Effective search space used: 114163 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory