Align putrescine transport system permease protein PotH (characterized)
to candidate SMc00772 SMc00772 putrescine ABC transporter permease
Query= CharProtDB::CH_088338 (317 letters) >FitnessBrowser__Smeli:SMc00772 Length = 303 Score = 340 bits (872), Expect = 3e-98 Identities = 168/291 (57%), Positives = 223/291 (76%), Gaps = 5/291 (1%) Query: 30 KLVIALPYIWLILLFLLPFLIVFKISLAEMARAIPPYTELMEWADGQLSITLNLG----- 84 +LVI +PY WL+ FL+PF IVF+ISL++ A A+PPY + + A G I LG Sbjct: 11 RLVIIIPYAWLLFFFLIPFFIVFRISLSQTAVAMPPYMPVFDLAGGLSGIMEKLGEFSLD 70 Query: 85 NFLQLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPLAWAVAHSKPSTRNILLLLVILPSW 144 N++ LT+D LYF+AY+ S+ +AAISTF LLIGYP+A+ +A + S R LL++VILP W Sbjct: 71 NYVWLTEDVLYFNAYVSSVVIAAISTFLTLLIGYPIAYGMAKAPRSLRPTLLMIVILPFW 130 Query: 145 TSFLIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTILHTNLAVYIGIVYAYVPFMVLPIY 204 TSFLIRVYAW+ ILK G+LN L +G+IDQPL IL+TNLA+YIGIVY+Y+PFMVLPIY Sbjct: 131 TSFLIRVYAWIAILKPEGLLNQVLSAVGLIDQPLIILNTNLAIYIGIVYSYLPFMVLPIY 190 Query: 205 TALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGGIIAGSMLVFIPAVGEFVIPELLGG 264 +AL ++D+SL EAA DLG P F+ V PL+ G++AG +LVFIPAVGEFVIP+LLGG Sbjct: 191 SALEKMDHSLTEAAQDLGCTPAAAFWRVTFPLSLPGVVAGCLLVFIPAVGEFVIPDLLGG 250 Query: 265 PDSIMIGRVLWQEFFNNRDWPVASAVAIIMLLLLIVPIMWFHKHQQKSVGE 315 +++MIG+ LW EF +NRDWPV+SAVAII+L++L++PI++F Q K+ GE Sbjct: 251 SETLMIGKTLWSEFNSNRDWPVSSAVAIILLMILVIPIVYFQNIQAKADGE 301 Lambda K H 0.328 0.144 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 303 Length adjustment: 27 Effective length of query: 290 Effective length of database: 276 Effective search space: 80040 Effective search space used: 80040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory