Align Putrescine-binding periplasmic protein SpuD (characterized)
to candidate SMc00770 SMc00770 putrescine-binding periplasmic protein
Query= SwissProt::Q02UB7 (367 letters) >FitnessBrowser__Smeli:SMc00770 Length = 364 Score = 388 bits (996), Expect = e-112 Identities = 194/368 (52%), Positives = 260/368 (70%), Gaps = 5/368 (1%) Query: 1 MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVY 60 M K TL LAGS + A +V++VYNWSDYI LE+FTKETGIKVVYDV+ Sbjct: 1 MSKLIVATLTTAVLAGST--ILAFAQERVVNVYNWSDYIDDSILEEFTKETGIKVVYDVF 58 Query: 61 DSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEV 120 DSNE+LE KLLAG SGYDVVVP+ FL +QI AGV+QKLDKSKLPN N+ +M Sbjct: 59 DSNEILETKLLAGGSGYDVVVPTAYFLQRQIAAGVFQKLDKSKLPNISNMWDMVMERTAQ 118 Query: 121 SDPGNEHAIPYMWGTIGIGYNPDKVKAAFG-DNAPVDSWDLVFKPENIQKLKQCGVSFLD 179 DPGNE+A+ YMWGT GIGYN +K+K G D P +WD++F PE K K CG+ LD Sbjct: 119 YDPGNEYAVDYMWGTTGIGYNVEKMKEILGTDEKP--NWDVIFDPEIAAKFKDCGIHLLD 176 Query: 180 SPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAI 239 SPT+I+P+AL YLG PD+ + +L+ A +L +K+RP + FHSS+YI+ LANG+IC+A+ Sbjct: 177 SPTDIMPSALAYLGLNPDSHDQADLEKAADLLMKVRPNIRKFHSSEYINALANGDICLAV 236 Query: 240 GYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKP 299 G+SGD++QA+ RA EAK VTV Y+IP++GA +FDM+AIP DA + A F+N++MKP Sbjct: 237 GFSGDVFQARDRAAEAKAGVTVDYSIPEQGAQMWFDMLAIPADAPHVAEAHEFINYMMKP 296 Query: 300 EIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRS 359 E++A+ ++ V + NGN A+ + + + D IYPS+ VM+KL+T AK QR +TR Sbjct: 297 EVIAKASNYVFYANGNKASQQFLDKEVLEDTAIYPSDAVMQKLFTTTPFEAKEQRVLTRL 356 Query: 360 WTKIKSGK 367 WT+I +G+ Sbjct: 357 WTRIVTGQ 364 Lambda K H 0.315 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 364 Length adjustment: 30 Effective length of query: 337 Effective length of database: 334 Effective search space: 112558 Effective search space used: 112558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory