Align Putrescine-binding periplasmic protein (characterized)
to candidate SMc01632 SMc01632 periplasmic binding ABC transporter protein
Query= SwissProt::P31133 (370 letters) >FitnessBrowser__Smeli:SMc01632 Length = 387 Score = 114 bits (286), Expect = 3e-30 Identities = 97/322 (30%), Positives = 144/322 (44%), Gaps = 25/322 (7%) Query: 19 AVSVGTLAAEQKTLHIYNWSDYIAPDTVANFEKETGIKVVYDVFDSNEVLEGKLMAGSTG 78 A + G L + + I W +Y P T F TG+ V +VF SNE + KL AG G Sbjct: 57 AYAAGDLGTQ---MSIATWPNYHDPATFEAFTAATGVAVEVNVFGSNEEMLAKLQAGGIG 113 Query: 79 FDLVVPSASFLERQLTAGVFQPLDKSKLPEWKNLDPELLKLVAKHDPDNK-FAMPYMWAT 137 +DL VP+ + + G+ LD SKLP + + E + + + K +A+P W T Sbjct: 114 WDLFVPTNYTISTYVKLGLIDELDLSKLPNY-DASTENARFTNEGIVEGKTYAVPKNWGT 172 Query: 138 TGIGYNVDKVKAVLGENAPVDSWDLILKPENLEKLKSCGVSFLDAPEEVFATVLNYLGKD 197 TGI N DK+K APV SW + E V D L LG Sbjct: 173 TGIAVNSDKIK------APVASWKDFFEIAMTEADGRAMVH--DYQLTTIGNALVSLGFS 224 Query: 198 PNSTKADDYTGPATDLLLKLRPNIRYFHSSQYINDLANGDICVAIGWAGDVWQASNRAKE 257 NS K ++ A +LL+K++P++ Y +S Y + D + + W D Q + E Sbjct: 225 FNSIKPEE-LAKAEELLIKVKPHL-YAINSDYQPSMRATDAWMTMCWTNDGAQLNRDMPE 282 Query: 258 AKNGVNVSFSIPKEGAMAFFDVFAMPADAKNKDEAYQFLNYLLRP--DVVAHISDHVFYA 315 K F + K+G + D +A+P A NK Y L+YL+ P V HI++ Sbjct: 283 IK------FVLGKDGGEIWSDFYAIPKSAANKPAGYALLDYLMTPANAVKEHIANGA--P 334 Query: 316 NANKAATPLVSAEVRENPGIYP 337 + L+ A+V N +YP Sbjct: 335 TTDSRVMKLLPADVTSNKIVYP 356 Lambda K H 0.317 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 387 Length adjustment: 30 Effective length of query: 340 Effective length of database: 357 Effective search space: 121380 Effective search space used: 121380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory