Align Gamma-glutamyl-putrescine synthetase (EC 6.3.1.11) (characterized)
to candidate SMc00762 SMc00762 glutamine synthetase
Query= reanno::BFirm:BPHYT_RS23160 (444 letters) >FitnessBrowser__Smeli:SMc00762 Length = 478 Score = 511 bits (1316), Expect = e-149 Identities = 247/444 (55%), Positives = 318/444 (71%), Gaps = 8/444 (1%) Query: 6 DFLKKNRVTEIEAIIPDMAGIARGKIIPRSKFESGESMRLPQAVMIQTVTGDYPEDGTLT 65 D+LK + +IE I PD+AG+ARGK++P SKF S S+ LP A+ T++G+YPE+ T Sbjct: 38 DWLKIRGIEDIECITPDLAGVARGKMMPTSKFTSNTSLALPSAIYRHTISGEYPEE---T 94 Query: 66 GV-----TDPDMVCVPDASTIRMIPWAVDPTAQVIHDCVHFDGTPVAISPRRVLRRVLEL 120 G D D+ VPD ST+ ++PW DPTAQVI D V G ++ +PR VL+RV+EL Sbjct: 95 GQFRYDSRDSDIKLVPDLSTLSIVPWESDPTAQVICDIVGSQGEQISYTPRNVLKRVIEL 154 Query: 121 YKAKGWKPVIAPELEFYLVDMNKDPDLPLQPPIGRTGRPETGRQAYSIEAVNEFDPLFED 180 Y+ KGWKPV+APE+EFYLV N DPD PL+PP GR+GR G Q YSI +NEFD L +D Sbjct: 155 YRQKGWKPVVAPEIEFYLVAQNDDPDYPLRPPKGRSGRSILGGQGYSIAGINEFDELIDD 214 Query: 181 IYEYCEVQELEVDTLIHEVGAAQMEINFMHGDPLKLADSVFLFKRTVREAALRHKMYATF 240 IY + E Q LE+DTLIHE G AQ+EIN HGDP++LAD VFLFKRT+REAAL+H +YATF Sbjct: 215 IYHFSEKQGLEIDTLIHEEGPAQLEINLRHGDPIELADQVFLFKRTIREAALKHGIYATF 274 Query: 241 MAKPMEGEPGSAMHMHQSLVDEETGHNLFTGPDGKPTSLFTSYIAGLQKYTPALMPIFAP 300 MAKPM+G+PGSAMH+HQS++D ETG N+F+ PDG P+ F S+I G+Q Y P + + AP Sbjct: 275 MAKPMQGQPGSAMHIHQSVIDIETGRNIFSNPDGSPSQAFFSFIGGMQLYVPRTLSMMAP 334 Query: 301 YINSYRRLSRFMAAPINVAWGYDNRTVGFRIPHSGPAARRIENRIPGVDCNPYLAIAATL 360 Y+NSYRRL+ M+AP+N AWGYDNRT FRIP S P ARRIENR+P D NPYLA+AA+L Sbjct: 335 YVNSYRRLTPDMSAPVNTAWGYDNRTTAFRIPVSDPVARRIENRLPSSDANPYLALAASL 394 Query: 361 AAGYLGMTQKLEATEPLLSDGYELPYQLPRNLEEGLTLMGACEPIAEVLGEKFVKAYLAL 420 GYLG+ + L+AT P E +LPR L E ++L+ + +AEV +F+ Y + Sbjct: 395 GCGYLGIIEGLQATPPTEHTANEGEIELPRGLLEAVSLLESAPALAEVFSAEFIAIYAGV 454 Query: 421 KETEYEAFFRVISSWERRHLLLHV 444 K E+E F +VIS WER LLL+V Sbjct: 455 KRGEFETFMQVISPWEREFLLLNV 478 Lambda K H 0.321 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 669 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 478 Length adjustment: 33 Effective length of query: 411 Effective length of database: 445 Effective search space: 182895 Effective search space used: 182895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory