Align Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94) (characterized)
to candidate SMc03943 SMc03943 hypothetical protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_4510 (258 letters) >FitnessBrowser__Smeli:SMc03943 Length = 251 Score = 198 bits (504), Expect = 8e-56 Identities = 107/241 (44%), Positives = 146/241 (60%) Query: 5 PLIGVTTCSRQIGLHAYHISGEKYSRAVATAAKGLPVLIPSLADLFPPSDILDALDGILL 64 P++ + R+ + +H++ +Y RA A + L+P+L +ILD +DG+L Sbjct: 4 PVVAIPCDFREFDGNVWHVAAHQYVRAAVEGAGLMVFLVPALEAGNDVDEILDRVDGVLA 63 Query: 65 TGSPSNVEPFHYQGPASAPGTAHDPARDATTLPLIRAAVDAGIPVLGICRGFQEMNVAFG 124 +G+ SNV P Y AS DP RDAT+LPLIR A+D G+P+ ICRG QE+NVA G Sbjct: 64 SGARSNVHPSLYGREASEADGPFDPGRDATSLPLIRRALDRGVPLFAICRGIQELNVALG 123 Query: 125 GSLHQKVHEVGTFIDHREDDTQAVDVQYGPAHAVHIQPGGVLAGLGLPQRIEVNSIHSQG 184 G+L ++ E DHR+ + +DV YG V ++ G LA + R+ VNS+H Q Sbjct: 124 GTLASEIQEQPGIWDHRKPEVPDLDVAYGIRQDVVVKEGSCLAPVLGTGRVRVNSLHRQA 183 Query: 185 IERLAPGLRAEAVAPDGLIEAVSVPGGKAFALGVQWHPEWEVSSNPHYLAIFQAFGDACR 244 I AP L EAVA DG IEAVSV G KAFA+GVQWHPE+ V ++ A+F+AFGDA R Sbjct: 184 IGAAAPRLAVEAVADDGTIEAVSVIGAKAFAVGVQWHPEYWVRTDAPSAALFKAFGDAAR 243 Query: 245 A 245 A Sbjct: 244 A 244 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 251 Length adjustment: 24 Effective length of query: 234 Effective length of database: 227 Effective search space: 53118 Effective search space used: 53118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory