Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate SMc02037 SMc02037 oxidoreductase
Query= SwissProt::A3LZU7 (258 letters) >FitnessBrowser__Smeli:SMc02037 Length = 256 Score = 157 bits (397), Expect = 2e-43 Identities = 88/254 (34%), Positives = 141/254 (55%), Gaps = 7/254 (2%) Query: 5 LNGKVVAITGGVTGIGRAIAIEMARNGAKVVVNHLPSEEQAQLAKELKEEISDGENNVLT 64 LNG+ +TGG GIG A A + GA+V ++ +E + ++L+++ + + Sbjct: 8 LNGRAAFVTGGSRGIGFACAEALGEAGARVAISARSRDEGEKAVRQLRQKGIEA----IY 63 Query: 65 IPGDISLPETGRRIVELAVEKFGEINVFVSNAGVCGFREFLEITPETLFQTVNINLNGAF 124 +P DIS +++V A + G +++ V+NAG+ + L++ PET + +N NL G F Sbjct: 64 LPADISNESAAQQVVRQAAAELGGLDILVNNAGIARHCDSLKLEPETWDEVINTNLTGLF 123 Query: 125 FAIQAAAQQMVKQGKGGSIIGISSISALVGGA--HQTHYTPTKAGILSLMQSTACALGKY 182 + +AA + M G+G SI+ I SIS + +Q Y +KAG+ L +S A K Sbjct: 124 WCCRAAIETMSAAGRG-SIVNIGSISGYISNLPQNQVAYNASKAGVHMLTKSLAGEFAKS 182 Query: 183 GIRCNAILPGTISTALNEEDLKDPEKRKYMEGRIPLGRVGDPKDIAGPAIFLASDMSNYV 242 IR NA+ PG I TA+ + L DPE K G PLGR G ++A +FLASD ++Y+ Sbjct: 183 NIRINAVAPGYIETAMTQGGLDDPEWSKIWLGMTPLGRAGKASEVAAAVLFLASDAASYI 242 Query: 243 NGAQLLVDGGLFVN 256 G+ L +DGG ++ Sbjct: 243 TGSVLTIDGGYTIH 256 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 256 Length adjustment: 24 Effective length of query: 234 Effective length of database: 232 Effective search space: 54288 Effective search space used: 54288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory