Align Putative L-rhamnonate dehydratase; RhamD; EC 4.2.1.90 (uncharacterized)
to candidate SM_b20510 SM_b20510 galactonate dehydratase
Query= curated2:A8MA91 (398 letters) >FitnessBrowser__Smeli:SM_b20510 Length = 382 Score = 119 bits (297), Expect = 2e-31 Identities = 88/270 (32%), Positives = 141/270 (52%), Gaps = 15/270 (5%) Query: 68 VEVESSDGEVGFG--ISTGGYPAAWIIENHLSRFVVGKYVGEVEKTWDQMFKATIYYGRR 125 +++E+ +G VG+G + G + LS ++VGK +E W+ +++ Y G Sbjct: 18 LKIETDEGVVGWGEPVVEGRALTVEAAVHELSDYLVGKDPFLIEDHWNVLYRGGFYRGG- 76 Query: 126 GIVMNAISAVDLALWDLMGKVRGLPVYDLLGGPVRDELTFYA--TGPRP-DVAKSLGFI- 181 I M+A++ +D ALWD+ GK G PV+ LLGG RD + Y+ G RP DVA + + Sbjct: 77 AIHMSALAGIDQALWDIKGKALGQPVHSLLGGQCRDRIKVYSWIGGDRPSDVANNAREVV 136 Query: 182 --GGKLPLIHG-----PADGIEGLRENVRIFKEAREKVGDDFLLMYDCWMSLDLPYAQRL 234 G K ++G D E + + V R+ +G + D + P A+ L Sbjct: 137 ARGFKAIKLNGCEEMQIVDTNEKIDKAVETIGLIRDAIGPHVGIGVDFHGRVHRPMAKVL 196 Query: 235 LSELKPYGLFWIEEPFIPDDYWSFGALANIAPPTLVASGEHESTVHGFRLLLELGKVNVI 294 EL+P+ L +IEEP + ++ + +AN T +A GE + F+ +L G V++I Sbjct: 197 AKELEPFKLMFIEEPVLSENREALREIANHC-STPIALGERLYSRWDFKSVLSDGFVDII 255 Query: 295 QPDVTWVGGVTPMIKIAALAEAYGAWVIPH 324 QPD++ GG+T KIAA+AEAY + PH Sbjct: 256 QPDLSHAGGITECRKIAAMAEAYDVALAPH 285 Lambda K H 0.321 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 382 Length adjustment: 30 Effective length of query: 368 Effective length of database: 352 Effective search space: 129536 Effective search space used: 129536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory