Align L-lactaldehyde reductase (EC 1.1.1.77) (characterized)
to candidate SMa0263 SMa0263 alcohol dehydrogenase
Query= metacyc::STM4044-MONOMER (382 letters) >FitnessBrowser__Smeli:SMa0263 Length = 399 Score = 174 bits (442), Expect = 3e-48 Identities = 133/394 (33%), Positives = 191/394 (48%), Gaps = 27/394 (6%) Query: 5 LALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMSYHLF 64 L P+ L GAG + +A K +ALIVTD +L L +L L+E + + Sbjct: 7 LRAPRELLFGAGQ-RHALGGIAAKLGHRALIVTDTRLAVDADLLALVRRLEEAGLEVMVD 65 Query: 65 DEVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYSGVGK 124 P+ E AA D +I GGGS +D AK V +L + G Y G Sbjct: 66 SSTLPDVPVESAIVSAAAASGFAPDLVIGIGGGSCLDMAKCVTLLLTHGGRPQDYYGEYA 125 Query: 125 VKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVMLEIPA 184 V +PL+AI TTAGT +E+T AV+ D+ R +K I P++IP +++ D + L P Sbjct: 126 VPGPVMPLIAIPTTAGTGSEVTPVAVLSDAERSLKVGISSPHLIPAVSICDPELTLSCPP 185 Query: 185 SVTAATGMDALTHAVEAY---------------VSVGAHPLTDANALEAIRLINLWLPKA 229 +TA G DALTHA+EA+ V VG + L+D AL AI L+ L +A Sbjct: 186 GLTAIAGADALTHAIEAFTAIRREPVPGIAQQRVFVGKNELSDHFALSAITLLWQGLERA 245 Query: 230 VDDGHNLEAREQMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVEN 289 DG + ARE + G LAG+AF AG HA+ + GA + HG+ A L+P V Sbjct: 246 CKDGADAGARETVMLGATLAGLAFGVAGTAAAHAIQYPVGALTHTAHGLGVACLMPYVMT 305 Query: 290 FNRPNAVARFARIAQAMGVETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDI 349 +N P A+IA A G+ E I A+ +L +R+GIP LG+ ++ I Sbjct: 306 WNAPLIRDELAQIAHAAGL--------GGPDEVIPALVSLFERIGIPATLRDLGLEEDRI 357 Query: 350 EGWLDKALAD--PCAPCNPRTASRDEVRGLYLEA 381 + W+ + + NPR + E+R L A Sbjct: 358 D-WVAEQSSGIARLIQNNPRPLNPHEMRNLVAAA 390 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 399 Length adjustment: 31 Effective length of query: 351 Effective length of database: 368 Effective search space: 129168 Effective search space used: 129168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory