GapMind for catabolism of small carbon sources

 

Alignments for a candidate for rhaM in Sinorhizobium meliloti 1021

Align L-rhamnose mutarotase; EC 5.1.3.32; Rhamnose 1-epimerase; Type-3 mutarotase (uncharacterized)
to candidate SM_b21108 SM_b21108 hypothetical protein

Query= curated2:A5FC30
         (107 letters)



>FitnessBrowser__Smeli:SM_b21108
          Length = 109

 Score = 58.2 bits (139), Expect = 3e-14
 Identities = 34/95 (35%), Positives = 53/95 (55%), Gaps = 9/95 (9%)

Query: 20  EYKIRHDQIWPELTALLSESGICDYSIFLDEETGILFGV-QKLSSGF--DRSQLSSHPLM 76
           EYK  H  +WPE+ AL+SE  I +YSIFL E   +LFG  + +   F  D +++++HP  
Sbjct: 17  EYKRLHAAVWPEILALISECNITNYSIFLKEPENLLFGYWEYVGEDFEADMTKMAAHPKN 76

Query: 77  RKWWNHMSDIMETNPDNSPKTNS----LKEVFHLD 107
           ++WW+      +  P  S +       ++EVFH D
Sbjct: 77  QEWWSVCMPCQK--PLESRRQGEWWAMMEEVFHHD 109


Lambda     K      H
   0.317    0.132    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 41
Number of extensions: 3
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 107
Length of database: 109
Length adjustment: 12
Effective length of query: 95
Effective length of database: 97
Effective search space:     9215
Effective search space used:     9215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)
S2: 40 (20.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory