Align RhaQ (characterized, see rationale)
to candidate SM_b20929 SM_b20929 sugar uptake ABC transporter permease
Query= uniprot:Q7BSH2 (337 letters) >FitnessBrowser__Smeli:SM_b20929 Length = 332 Score = 169 bits (427), Expect = 1e-46 Identities = 98/302 (32%), Positives = 159/302 (52%), Gaps = 4/302 (1%) Query: 24 IAASWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMALLVISGEID 83 + AS + +L +F S+A+ F A NL + T NFT A+IA M L++I+G ID Sbjct: 20 LLASQAFWVLVAVILACLFLSIATDSFATAKNLYNITRNFTFVAIIALGMTLVIITGGID 79 Query: 84 LSVAAIIALASTAMGAAVQIGIGTPGLVLIGIGTGLACGVFNGVLVSVLKLPSIVVTIGT 143 LSV +++ L S + + G G + IGT L G FNGV+++ L P V+T+G Sbjct: 80 LSVGSVLCLCSMVLAVVMHAGYGIEVGIAASIGTALVAGAFNGVMIAYLGFPPFVITLGM 139 Query: 144 MSLFRGISYIVLGDQAYGKYPADF-AYFGQGYVVWVFSF--EFVLFIVLAVLFAILLHAT 200 +S+ R ++ + + ++ D G W + IVLA+L +L T Sbjct: 140 LSIARSLAMVASNNTVVFEFGPDHDTLLALGGGAWFLGIANPVLYMIVLALLTGFVLRWT 199 Query: 201 NFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLGSTRPSIAQGW 260 FGR V+AIG N+ AA +G+PV R+K +++++ + +GIA + T LG+ +I G Sbjct: 200 KFGRYVFAIGGNEHAATLTGVPVRRIKVAVYMISALAAGIAGIIQTGWLGAVTTNIGAGM 259 Query: 261 ELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGIVMSIFIGLLIIV 320 EL+V+ V+GG ++ GG G + AA + ++ LGLL + FIG I++ Sbjct: 260 ELQVIAAAVIGGANLAGGAGTASGALIGAALI-EVIRNSLGLLGINAFWQGAFIGGAIVL 318 Query: 321 TI 322 + Sbjct: 319 AV 320 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 332 Length adjustment: 28 Effective length of query: 309 Effective length of database: 304 Effective search space: 93936 Effective search space used: 93936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory