Align RhaQ (characterized, see rationale)
to candidate SM_b21017 SM_b21017 sugar ABC transporter permease
Query= uniprot:Q7BSH2 (337 letters) >FitnessBrowser__Smeli:SM_b21017 Length = 337 Score = 178 bits (451), Expect = 2e-49 Identities = 100/310 (32%), Positives = 171/310 (55%), Gaps = 8/310 (2%) Query: 21 LRRIAASWEVLLFAVAVLIFVFNSLASPYFLDAWNLSDATFNFTEKAMIAFAMALLVISG 80 ++++ WE LFA+ V + L +P FL+ NL T +F + ++A + L++I+G Sbjct: 1 MKKLIFRWETALFAMLVAELLIFGLVNPRFLNLTNLIYGTSDFVQIGIVALPLTLVIIAG 60 Query: 81 EIDLSVAAIIALASTAMGAAVQIGIGTPGLVLIGIGTGLACGVFNGVLVSVLKLPSIVVT 140 ID+S A++I L + G A G+ P +L+ + TG CG+ N ++ + K+ +VVT Sbjct: 61 GIDVSFASVIGLTAIMFGVATFYGVPLPLSILLALVTGALCGLLNATVIHLSKIQPLVVT 120 Query: 141 IGTMSLFRGISYIVL------GDQAYGKYPADFAYFGQGYVVWVFSFEFVLFIVLAVLFA 194 +G++ LF+G + + G + G +P F FG + + LF+ L+++ Sbjct: 121 LGSLYLFQGTATVASGLVGAGGYEGIGNFPEAFNAFGYAEFLGL-PAPLALFLALSLVLI 179 Query: 195 ILLHATNFGRQVYAIGNNDFAARFSGIPVERVKSILFLLTGIMSGIAAVCLTSRLGSTRP 254 +LLH T FGR V+ G ++ AA F+GIPV RV++ +++TG+ + IA + +++ GS R Sbjct: 180 VLLHFTRFGRTVFLSGQSERAAHFAGIPVGRVQTFTYVITGVSAAIAGLVMSAYFGSARV 239 Query: 255 SIAQGWELEVVTMVVLGGISILGGFRHDRGVFVIAAFVMGLVTFGLGLLNLPGIVMSIFI 314 + L VT VLGG SI GG G ++A FV+G + GL +P + S Sbjct: 240 DLGSATLLPAVTAAVLGGASIYGGQGSILGT-LLATFVIGYLQQGLQAAGVPSQISSALS 298 Query: 315 GLLIIVTIAI 324 G L++V +A+ Sbjct: 299 GGLLVVAVAL 308 Lambda K H 0.330 0.145 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 337 Length adjustment: 28 Effective length of query: 309 Effective length of database: 309 Effective search space: 95481 Effective search space used: 95481 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory