Align D-ribose-binding periplasmic protein; EC 3.6.3.17 (characterized)
to candidate SM_b21377 SM_b21377 sugar uptake ABC transporter substrate-binding protein precursor
Query= CharProtDB::CH_003593 (296 letters) >FitnessBrowser__Smeli:SM_b21377 Length = 296 Score = 162 bits (409), Expect = 1e-44 Identities = 104/292 (35%), Positives = 158/292 (54%), Gaps = 8/292 (2%) Query: 1 MNMKK-LATLVSAVALSATVSANAMAKDTIALVVSTLNNPFFVSLKDGAQKEADKLGYNL 59 MNM + L TLV+ AL T+ A+ D I + T +PF++ L + + EA + L Sbjct: 1 MNMPRILKTLVAGTAL--TLLASGAFADGIGASLLTQQHPFYIELAEAMKAEAKEKNVAL 58 Query: 60 VVLDSQNNPAKELANVQDLTVRGTKILLINPTDSDAVGNAVKMANQANIPVITLDRQATK 119 V + + K+LA+V+D V+G +++I+P DS V A+ A +A I VIT+D A Sbjct: 59 EVAIANQDLNKQLADVEDFIVKGVDVIVISPVDSQGVRAAIAKAEKAGIKVITVDVPANG 118 Query: 120 GEVVSHIASDNVLGGKIAGDYIAKKAGEGAKVIELQGIAGTSAARERGEGFQQAVAAHKF 179 V SHI +DN GG AG+ +A+ G KV + + R GF++A+A H Sbjct: 119 ATVTSHIGTDNFTGGVKAGELMAEVLGNKGKVAIID-YPTVQSVVNRVNGFKEAIAKHPE 177 Query: 180 NVLASQPADFDRIKGLNVMQNLLTAHPDVQAVFAQNDEMALGALRALQTAG-KSDVMVVG 238 + + R + L QN+L A+PD+ +F D+ AL A A++ AG +S V V+G Sbjct: 178 MEIVATQTGITRAEALAAAQNMLQANPDITGIFGFGDDAALAAAVAVKAAGLESQVKVIG 237 Query: 239 FDGTPDGEKAVNDGK--LAATIAQLPDQIGAKGVETADKVLKGEKVQAKYPV 288 FDG + AV DG + I Q PDQ+G + ++TA KV+ GE V A+ P+ Sbjct: 238 FDGMKEARDAV-DGNPVMVGVIQQFPDQMGKQAIDTAVKVVAGETVPAEQPI 288 Lambda K H 0.313 0.129 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 296 Length adjustment: 26 Effective length of query: 270 Effective length of database: 270 Effective search space: 72900 Effective search space used: 72900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory