Align ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized)
to candidate SM_b20352 SM_b20352 sugar ABC transporter permease
Query= TCDB::Q9X050 (331 letters) >FitnessBrowser__Smeli:SM_b20352 Length = 354 Score = 269 bits (687), Expect = 9e-77 Identities = 131/319 (41%), Positives = 202/319 (63%), Gaps = 8/319 (2%) Query: 16 ISRYQSIFILLGLIVLFSFLSNRFLTLENFWIILRQTAVNLCIAVGMTFVILTGGIDLSV 75 + + ++ L ++ FS + FL+ N ++ + A+N +A+GMTFVI+TGGIDLSV Sbjct: 22 LMKLRTFIALFAVVAFFSIFAPNFLSTANLILMSKHVALNAFLAMGMTFVIITGGIDLSV 81 Query: 76 GSILGFSGAVTAKLLKYGLILSAFGVVLKFNPLGASIIGVLAGFAIGLFNGFIITRFNIP 135 GSI+G G V L+ G+ L FG + FN + +I + G IG NG +IT+ N+ Sbjct: 82 GSIVGLCGMVAGGLILNGIDLQ-FGYTVYFNVVEVCLITLAVGIVIGAVNGLLITKLNVA 140 Query: 136 PFVATLGTMTAVRGFIMLLTKGHPITRL-------GDSFDFIGSGWFLGIPMPVWIAAIA 188 PF+ATLGT+ RGF +L + G L F F+GSG LG+P+ +W+ + Sbjct: 141 PFIATLGTLYVARGFALLSSGGQTFPNLVGKPELATTGFAFLGSGRLLGLPVSIWVLIVV 200 Query: 189 TGVGIFILRKTQFGRYVYAVGGNEKAAVLSGVNSKLTKLWVYAISGILSAVAGLIVTARL 248 ++ R T GR+++AVGGNE+AA +SG+ K++VY SG +A+ GL++++ L Sbjct: 201 ALAAAYVARYTPIGRHIFAVGGNERAARMSGIRVDRVKMFVYMFSGFCAAIVGLVISSEL 260 Query: 249 DSAQPNAGLMYELDAIAATVIGGASLSGGKGTLIGTVVGALIIGVLNDGLVLVGVSPFWQ 308 ++ P G +EL+AIAA V+GG S+SGG+GT+ GT++GA +IG+L+DGLV++G+S FWQ Sbjct: 261 MASHPATGNSFELNAIAAAVLGGTSMSGGRGTIGGTIIGAFVIGILSDGLVMMGISSFWQ 320 Query: 309 QVAKGFIIIAAVIAEKLGR 327 V KG +II AV+ ++ R Sbjct: 321 MVIKGIVIIVAVVVDQAQR 339 Lambda K H 0.327 0.144 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 35 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 354 Length adjustment: 29 Effective length of query: 302 Effective length of database: 325 Effective search space: 98150 Effective search space used: 98150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory