Align ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized)
to candidate SM_b21375 SM_b21375 sugar uptake ABC transporter permease
Query= TCDB::Q9X050 (331 letters) >FitnessBrowser__Smeli:SM_b21375 Length = 320 Score = 248 bits (634), Expect = 1e-70 Identities = 132/318 (41%), Positives = 204/318 (64%), Gaps = 12/318 (3%) Query: 4 ERSRAKISWYQRISRYQSIFI-LLGLIVLFSFLSNRFLTLENFWIILRQTAVNLCIAVGM 62 + + AK + + + +Y IF+ L+ L ++FSF + RF+T+ NF IL+Q AV A GM Sbjct: 3 QNTAAKAALVRALKQYGGIFLSLVMLCIVFSFFNPRFMTVVNFMNILQQVAVVAIAAFGM 62 Query: 63 TFVILTGGIDLSVGSILGFSGAVTAKLLKYGLILSAFGVVLKFNPLGASIIGVLAGFAIG 122 T+VIL G IDLSVGSI+ +G V A+ +G+ F P A + + AG +G Sbjct: 63 TWVILLGEIDLSVGSIIAVAGMVGAQCFAFGM---------GFAP--AIALTLAAGALMG 111 Query: 123 LFNGFIITRFNIPPFVATLGTMTAVRGFIMLLTKGHPITRLGDSFDFIGSGWFLGIPMPV 182 + NG + + +P F+ T+ TM RG + L T G P +++ IG+ FLG+P+ + Sbjct: 112 MLNGVLTAKLLLPSFIVTVATMGIYRGMVSLPTNGAPAMIENETWTAIGTESFLGLPIII 171 Query: 183 WIAAIATGVGIFILRKTQFGRYVYAVGGNEKAAVLSGVNSKLTKLWVYAISGILSAVAGL 242 W+ A+ + +L KT FGR Y GGN +AAV SG+ K+ ++ ISG+++A++G+ Sbjct: 172 WVVAVLFVINQIVLSKTSFGRRAYLTGGNREAAVYSGIKVDRLKILIFMISGVMAAISGV 231 Query: 243 IVTARLDSAQPNAGLMYELDAIAATVIGGASLSGGKGTLIGTVVGALIIGVLNDGLVLVG 302 ++++RL SAQ NAG+ YELDAIAA V+GG SL+GG GT++GT++GALIIGV+N+G+ ++ Sbjct: 232 LLSSRLFSAQTNAGMSYELDAIAAAVLGGTSLAGGVGTMVGTLIGALIIGVMNNGMNMLS 291 Query: 303 VSPFWQQVAKGFIIIAAV 320 V F+Q + KG +I+ AV Sbjct: 292 VPYFYQLIVKGLVILVAV 309 Lambda K H 0.327 0.144 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 320 Length adjustment: 28 Effective length of query: 303 Effective length of database: 292 Effective search space: 88476 Effective search space used: 88476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory