Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate SMc01949 SMc01949 high-affinity branched-chain amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__Smeli:SMc01949 Length = 295 Score = 201 bits (512), Expect = 1e-56 Identities = 113/262 (43%), Positives = 158/262 (60%), Gaps = 10/262 (3%) Query: 5 SNEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAG 64 + + +LKV +S RFGGL A++D +RG++ LIGPNGAGKTT FN ITG Y P G Sbjct: 9 TKDPILKVERLSMRFGGLMAINDFSFEAERGEITALIGPNGAGKTTVFNCITGFYKPTMG 68 Query: 65 TFELAGKPYEPTAVHEV------AKAGIARTFQNIRLFAEMTALENVMVGRH---IRTGS 115 + K + + KA +ARTFQNIR+F+ +T LEN++V +H +R Sbjct: 69 MITMRQKSGAEFLLERLPDFEITKKAKVARTFQNIRMFSGLTVLENLLVAQHNKLMRASG 128 Query: 116 GLFGAVFRTKGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATD 175 +F ++ + A+ L+ + + AD A L YG QRRLEIARA+ T Sbjct: 129 YTILGLFGFPAYREASRESIELARHWLEKASLTERADDPAGDLPYGAQRRLEIARAMCTG 188 Query: 176 PQLIALDEPAAGMNATEKVQLRELIDRIRNDNRT-ILLIEHDVKLVMGLCDRVTVLDYGK 234 P+L+ LDEPAAG+N E + L L+ IR D T ILLIEHD+ +VM + D V VL+YG+ Sbjct: 189 PELLCLDEPAAGLNPRESLALNALLQEIRRDTGTSILLIEHDMSVVMEISDHVVVLEYGQ 248 Query: 235 QIAEGNPAEVQKNEKVIEAYLG 256 +I++GNP V+ + +VI AYLG Sbjct: 249 KISDGNPDFVKNDPRVIAAYLG 270 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 295 Length adjustment: 25 Effective length of query: 235 Effective length of database: 270 Effective search space: 63450 Effective search space used: 63450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory