Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate SMc02357 SMc02357 high-affinity branched-chain amino acid ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >FitnessBrowser__Smeli:SMc02357 Length = 244 Score = 168 bits (426), Expect = 9e-47 Identities = 93/251 (37%), Positives = 146/251 (58%), Gaps = 22/251 (8%) Query: 19 LLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLFN 78 L +S F GLRA+DH + V G + GLIGPNG+GKTTL N ++ ++ G + Sbjct: 6 LAVNDVSVEFTGLRALDHVSLSVAAGEVVGLIGPNGSGKTTLINAITGQVKLATGTIAAG 65 Query: 79 GDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQK 138 ++ L+P +IAL G R+FQ+ ++ + +TV+EN+ A + + Sbjct: 66 DTTLSGLSPREIALAGVSRSFQIVRIFNSMTVMENVEAAALAKGASR------------- 112 Query: 139 EERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGVN 198 + E+A +L +GL AKA + +LS G ++ +E+ARAL + P+ +LLDEPAAG+N Sbjct: 113 --TVSAERAKGLLAELGLTAKADELGESLSYGDKRRVEIARALAAEPRFLLLDEPAAGMN 170 Query: 199 ----PTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQ 254 TL+ + E ++G+ L+I+H+M +IM LCH + VLA GR +A+G ++ Sbjct: 171 DAETETLLHTLAELP---EKRGLGLLIIDHDMGLIMRLCHRLHVLASGRTIAEGDAAHVR 227 Query: 255 SDPRVLEAYLG 265 S P V+EAYLG Sbjct: 228 SHPAVIEAYLG 238 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 244 Length adjustment: 24 Effective length of query: 243 Effective length of database: 220 Effective search space: 53460 Effective search space used: 53460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory