Align Threonine dehydratase 2 biosynthetic, chloroplastic; SlTD2; Threonine deaminase 2; EC 4.3.1.17; EC 4.3.1.19 (characterized)
to candidate SMc00936 SMc00936 threonine dehydratase
Query= SwissProt::P25306 (595 letters) >FitnessBrowser__Smeli:SMc00936 Length = 415 Score = 192 bits (488), Expect = 2e-53 Identities = 130/409 (31%), Positives = 200/409 (48%), Gaps = 10/409 (2%) Query: 99 VDILASPVYDVAIESPLELAEKLSDRLGVNFYIKREDKQRVFSFKLRGAYNMM-SNLSRE 157 V+ A+ + ++ +PL+L E LS R G ++KRED V S+K+RGA+N +L Sbjct: 5 VEKAAAAMREIFPPTPLQLNEHLSARCGATVFLKREDLSPVRSYKIRGAFNFFRKSLGSG 64 Query: 158 ELDKGVITASAGNHAQGVALAGQRLNCVAKIVMPTTTPQIKIDAVRALGGDVV---LYGK 214 K + ASAGNHAQG A + + MP TTPQ KID R G + + L G Sbjct: 65 AAGKTFVCASAGNHAQGFAFVCRHFGVPGVVFMPVTTPQQKIDKTRMFGAEFITIRLVGD 124 Query: 215 TFDEAQTHALELSEKDGLKYIPPFDDPGVIKGQGTIGTEINRQLKD---IHAVFIPVGGG 271 FD+ A E E G +PPFD +I+GQ T+ EI QL V +PVGGG Sbjct: 125 IFDQCYKAAREHVEAIGGVMVPPFDHDDIIEGQATVAAEIAEQLPAGPVADLVVLPVGGG 184 Query: 272 GLIAGVATFFKQIAPNTKIIGVEPYGAASMTLSLHEGHRVKLSNVDTFADGVAVALVGEY 331 GL AGV + + + EP GA S SL G V L VD F DG AVA +G+ Sbjct: 185 GLAAGVTGYLGDSLSADRFLFCEPEGAPSFRRSLELGGVVTLDQVDNFVDGAAVARIGDL 244 Query: 332 TFAKCQELI-DGMVLVANDGISAAIKDVYDEGRNILETSGAVAIAGAAAYCEFYKIKNEN 390 FA + + ++L+ + I I ++ + +LE +GA+AI A ++ + Sbjct: 245 NFAALRRFSPEQVMLLPENAICLTITEMLNVEGVVLEPAGALAITALEALGR-DSLEGKI 303 Query: 391 IVAIASGANMDFSKLHKVTELAGLGSGKEALLATFMVEQQGSFKTFVGLVGSL-NFTELT 449 +VA+ SG N DF +L V E A +G + M ++ G+ + F+GL+G + Sbjct: 304 VVAVVSGGNFDFERLPDVKERAMRHAGLKKYFILRMAQRPGALRDFLGLLGEEDDIARFE 363 Query: 450 YRFTSERKNALILYRVNVDKESDLEKMIEDMKSSNMTTLNLSHNELVVD 498 Y S R +L + + + + ++ + +++ NE++ + Sbjct: 364 YLKKSARNFGSVLIGIETKHAENFPVLKQRFDAAGLRYQDITENEMLAN 412 Lambda K H 0.317 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 529 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 595 Length of database: 415 Length adjustment: 34 Effective length of query: 561 Effective length of database: 381 Effective search space: 213741 Effective search space used: 213741 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory