Align SmoF, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate SMc01978 SMc01978 sugar transport system permease ABC transporter protein
Query= TCDB::O30832 (290 letters) >FitnessBrowser__Smeli:SMc01978 Length = 311 Score = 153 bits (387), Expect = 4e-42 Identities = 100/281 (35%), Positives = 152/281 (54%), Gaps = 7/281 (2%) Query: 8 TAARLMISPAVILLFLWMIVPLSMTLYFSFLRYNLLMPGMESFTGWDNYYYFLTDPAFSA 67 +A L +PA+IL+ M+VPL + + ++F LL P F G D++ D AF Sbjct: 25 SAPYLYTAPALILIVTVMLVPLVLGISYAFRDIQLLNPFSGGFVGLDHFRALAQDQAFFR 84 Query: 68 ALTNTILLVVGVLLITVVGGVLLALLLDQPFWGQGIVRVLVIAPFFVMPTVSALVWKNMF 127 +L NT+ + + G++LALLLD+PF G+ I + LV P+ V ++ L W +F Sbjct: 85 SLRNTLWWTGASVFLQFAFGLILALLLDKPFHGRAIAQALVFLPWAVPSFLAGLNWAWLF 144 Query: 128 MNPVNGMFAHIARGLGL--PPFDFLSQAPLASIIGIVA--WQWLPFATLILLTALQSLDR 183 NPV G H LG+ P + LS LA IVA W +PF + LL ALQ++ R Sbjct: 145 -NPVVGPLPHWLFALGIMSQPTNILSDPQLAMWGPIVANIWWGIPFFAITLLAALQAIPR 203 Query: 184 EQMEAAEMDGASALDRFIHITVPHLTRAITVVVLIQTIFLLGVFAEILVTTNGGPGTAST 243 + EAA +DGA L RF+ IT+P L I + +L++T+++ I+V TNGGP + Sbjct: 204 DLYEAASIDGAGPLQRFLSITLPFLAPTIAITILLRTVWISNFADLIIVMTNGGPADRTQ 263 Query: 244 NITYLVYAQSLLNYDVGGGSAGGIVAVVLANIVAIFLMRMI 284 + ++ Q+ D G SA I V+LA ++A L+ +I Sbjct: 264 IVASYIFTQAFKRLDFGYASA--IALVLLALLLAYSLLIVI 302 Lambda K H 0.329 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 311 Length adjustment: 27 Effective length of query: 263 Effective length of database: 284 Effective search space: 74692 Effective search space used: 74692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory