Align ABC transporter for D-Sorbitol, permease component 1 (characterized)
to candidate SMc01979 SMc01979 sugar transport system permease ABC transporter protein
Query= reanno::BFirm:BPHYT_RS16105 (291 letters) >FitnessBrowser__Smeli:SMc01979 Length = 277 Score = 146 bits (368), Expect = 6e-40 Identities = 92/277 (33%), Positives = 153/277 (55%), Gaps = 7/277 (2%) Query: 19 AKSPFAAIRRGIPGVIAWLVALLLFFPIFWMTITAFKTEQQAYASSLFFIPT---LDSFR 75 AK F I + V+A++ L FP+FW+ A Y+ + P+ L+ F Sbjct: 3 AKQAFLTIAHRL-AVLAYIAFAL--FPLFWLLKVAVTPNDLLYSEGIRLWPSRASLEHFD 59 Query: 76 EVFARSNYFSFAWNSILISAGVTILCLILAVPAAYAMAFFPTRRTQKVLLWMLSTKMMPS 135 V S + F NS+++S ++ ILA + YA++ F R ++ ML T+M P Sbjct: 60 FVLRHSAFPVFFRNSLIVSGSTAVIVTILASLSGYALSRFRFRGKYWLVTLMLLTQMFPL 119 Query: 136 VGVLVPIYLLWKNSGLLDSVSGLVIVYTLINLPIAVWMSFTYFAEIPRDILEAGRIDGAA 195 V ++ PI+ + GL +S++GLV+VYT N+P A ++ ++F IP+D+ EA IDGA Sbjct: 120 VMLVAPIFKILSPLGLTNSLTGLVVVYTAFNVPFATFLMQSFFDGIPKDLEEAAMIDGAT 179 Query: 196 TWQEIVYLLMPMSLPGLASTALLLVILSWNEAFWSINLSSSNA-APLTVFIASYSSPEGL 254 + +++P++LPG+A+T + +W+E +S+ L S NA A V + S+ S + Sbjct: 180 QFVAFRQIILPLTLPGIAATLGFVFTAAWSELLFSLMLISGNAQATFPVGLLSFVSKFSV 239 Query: 255 FWAKLSAASLLAVAPILIVGWLSQKQLVRGLTFGAVK 291 + ++ AA +LA+ P + L Q+ LV+GLT GAVK Sbjct: 240 DFGQMMAAGVLALIPACLFFLLIQRYLVQGLTAGAVK 276 Lambda K H 0.326 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 277 Length adjustment: 26 Effective length of query: 265 Effective length of database: 251 Effective search space: 66515 Effective search space used: 66515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory