Align Fructokinase-2; ZmFRK2; EC 2.7.1.4 (characterized)
to candidate SM_b21374 SM_b21374 sugar kinase
Query= SwissProt::Q6XZ78 (335 letters) >FitnessBrowser__Smeli:SM_b21374 Length = 313 Score = 130 bits (328), Expect = 3e-35 Identities = 103/322 (31%), Positives = 148/322 (45%), Gaps = 22/322 (6%) Query: 19 VVSFGEMLIDFVPDVAGLSLAESGGFVKA-------PGGAPANVACAIAKLGGSSAFVGK 71 +++ GE+L++ + G GF KA P GAPA KLG A + + Sbjct: 4 ILTIGEILVEIIATEKG------DGFRKATPLIGPFPSGAPAIFIDQAGKLGQPCAIISR 57 Query: 72 FGDDEFGHMLVNILKQNNVNAEGCLFDKHARTALAFVTLKHDGEREFMFYRNPSADMLLT 131 G D+FG + + LK++ V+ G D A T AFV + DG R F+F SA +T Sbjct: 58 VGGDDFGTVNLERLKRDGVDISGIEVDPLATTGSAFVRYRPDGSRAFVFNIRDSACGKIT 117 Query: 132 EAELDLGLVRRARVFHYGSISLISEPCRSAHMAAMRAAKAAGVLCSYDPNVRLPLWPSPD 191 E LV H SL + + +AA+ KA G S+DPN+R + SP Sbjct: 118 LDERMTRLVGECSHVHVMGSSLYAPSVVESILAAIGIVKAGGGTVSFDPNLRPEILKSP- 176 Query: 192 AAREGILSIWKEADFIKVSDDEVAFLTRGDANDEKNVLSLWFDGLKLLVVTDGDKGCRYF 251 RE +L++ E D S DE+ FL + + V L G+K +VV G G YF Sbjct: 177 GMREALLTVLAETDLFLPSGDEL-FLFTEAKTESQAVAELLASGIKAVVVKRGAAGASYF 235 Query: 252 TKDFKGSVPGFKVDTVDTTGAGDAFVGSLLVNVAKDDSIFHNEEKLREALKFSNACGAIC 311 S+PGF V+ +D TGAGD F + + S + N REAL+F+ A GA Sbjct: 236 DAGAALSLPGFPVEEIDPTGAGDCFGATFV-------SFWLNGASPREALEFAAASGARA 288 Query: 312 TTKKGAIPALPTVATAQDLIAK 333 G + T A + I++ Sbjct: 289 VMHFGPMEGASTRAELERFISE 310 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 313 Length adjustment: 28 Effective length of query: 307 Effective length of database: 285 Effective search space: 87495 Effective search space used: 87495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory