Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate SMc02037 SMc02037 oxidoreductase
Query= BRENDA::Q1J2J0 (255 letters) >FitnessBrowser__Smeli:SMc02037 Length = 256 Score = 241 bits (616), Expect = 8e-69 Identities = 126/252 (50%), Positives = 168/252 (66%), Gaps = 9/252 (3%) Query: 12 DLFRLDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAAREL-----DGTF 66 +LFRL+GR A VTGG++GIGF A L +AGARV I+ + D GE A R+L + + Sbjct: 4 ELFRLNGRAAFVTGGSRGIGFACAEALGEAGARVAISARSRDEGEKAVRQLRQKGIEAIY 63 Query: 67 ERLNVTDADAVADLARR----LPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVF 122 ++++ A + R+ L +D+LVNNAGI R+ + + W V++ NL G+F Sbjct: 64 LPADISNESAAQQVVRQAAAELGGLDILVNNAGIARHCDSLKLEPETWDEVINTNLTGLF 123 Query: 123 WCCREFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRG 182 WCCR TM A GRG+IV+ S+SG ISN PQ Q AYNASKA V LT+SLAGE+A Sbjct: 124 WCCRAAIETMSAAGRGSIVNIGSISGYISNLPQNQVAYNASKAGVHMLTKSLAGEFAKSN 183 Query: 183 VRVNAVAPGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVT 242 +R+NAVAPGY T +T+ GL+ PEW + WL TPLGR + E+A AVL+LASDAAS++T Sbjct: 184 IRINAVAPGYIETAMTQGGLDDPEWSKIWLGMTPLGRAGKASEVAAAVLFLASDAASYIT 243 Query: 243 GHTLVVDGGYTV 254 G L +DGGYT+ Sbjct: 244 GSVLTIDGGYTI 255 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 256 Length adjustment: 24 Effective length of query: 231 Effective length of database: 232 Effective search space: 53592 Effective search space used: 53592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory