Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate SM_b21010 SM_b21010 D-beta-hydroxybutyrate dehydrogenase
Query= reanno::Koxy:BWI76_RS22230 (259 letters) >FitnessBrowser__Smeli:SM_b21010 Length = 258 Score = 115 bits (288), Expect = 9e-31 Identities = 82/256 (32%), Positives = 125/256 (48%), Gaps = 3/256 (1%) Query: 1 MNQVAVVIGGGQTLGEFLCRGLAAEGYRVAVVDIQSDKATRVAQSINAEYGEGTAWGFGA 60 M + AV+ G +G + R LA G + + + R A GT A Sbjct: 1 MTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPA 60 Query: 61 DATSEASVVALARGVDDIFSRVDLLVYSAGIAKAAFISDFALGDFDRSLQVNLVGYFLCA 120 D T + + + V D F D+LV +AG+ I DF + +DR + VNL F Sbjct: 61 DMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTI 120 Query: 121 REFSRLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVH 180 R M + G GRII I S G V S S Y AAK G +GLT+++AL++AE G+TV+ Sbjct: 121 RGAIPPMKKKGW-GRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVN 179 Query: 181 SLMLGNLLKSPMFQSLLPQYATKLGIPEEQV-EQYYIDKVPLKRGCDYQDVLNVLMFYAS 239 S+ G +L +P+ + +P A GI EEQV + + P K+ + V ++ ++ A Sbjct: 180 SICPGYVL-TPLVEKQIPDQARTRGITEEQVINEVMLKGQPTKKFITVEQVASLALYLAG 238 Query: 240 PQASYCTGQSINVTGG 255 A+ TG +++ GG Sbjct: 239 DDAAQITGTHVSMDGG 254 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 258 Length adjustment: 24 Effective length of query: 235 Effective length of database: 234 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory