Align Fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 (characterized)
to candidate SM_b20199 SM_b20199 fructose-1,6-bisphosphate aldolase
Query= SwissProt::Q56815 (354 letters) >FitnessBrowser__Smeli:SM_b20199 Length = 359 Score = 477 bits (1227), Expect = e-139 Identities = 235/349 (67%), Positives = 282/349 (80%) Query: 1 MALVSMRQLLDHAADDSYGLPAFNVNNMEQVKAIMDAARATSSPVILQGSAGARKYAGEP 60 MA +++RQLLDHAA+ SYG+PAFN+NNMEQ AIM+AARA+ +PVILQ S GAR YA + Sbjct: 1 MARITLRQLLDHAAERSYGVPAFNINNMEQGLAIMEAARASDAPVILQVSRGARSYANDV 60 Query: 61 FLRHLIAAAVEAYPEIPVVMHQDHGASPAVCMGAIKSGFSSVMMDGSLKEDGKTPADYDY 120 L ++ A E YP+IP+ +HQDHG + A C+ AI+ GF+SVMMDGSLKED KTPADYDY Sbjct: 61 MLAKMMEALEEMYPDIPLCIHQDHGNNVATCLTAIQHGFTSVMMDGSLKEDAKTPADYDY 120 Query: 121 NVSVTAKVVELAHAVGVSVEGELGCLGSLETGKGEAEDGHGAEEALDHSKLLTDPDEAAQ 180 NVS+TA+V LAH VG SVEGELGCLGSLETG GEAEDGHG E ALD S+LLTDPDEAA+ Sbjct: 121 NVSITAEVSRLAHMVGASVEGELGCLGSLETGHGEAEDGHGFEGALDRSQLLTDPDEAAR 180 Query: 181 FVKATQCDALAIAIGTSHGAYKFTRKPTGDILAIDRIKAIHQRIPTTHLVMHGSSSVPQE 240 FV T DALA+AIGTSHGAYKFTRKPTG++LA+D I+ IH+R+P TH+VMHGSSSVPQE Sbjct: 181 FVAETGVDALAVAIGTSHGAYKFTRKPTGEVLAMDVIEKIHERLPDTHIVMHGSSSVPQE 240 Query: 241 LLEEIRTYGGDIKETYGVPVEEIQEGIRYGVRKVNIDTDIRLAMTAAIRRVGAKNKSEFD 300 + +GG ++ETYGVPVEEI GIR+GVRKVNIDTD+RLA AA RRV ++SEFD Sbjct: 241 WQDVFNAHGGQMRETYGVPVEEIVRGIRFGVRKVNIDTDLRLAAAAAFRRVADTSRSEFD 300 Query: 301 PRKFMAAAMEEAKKVCIARFEAFGSAGKAEKIRAIELDEMAKRYASGEL 349 PRKF+ AM+ VC ARFEAFG+AG A +I+ + + EMA+RYASG L Sbjct: 301 PRKFLKPAMDAMSAVCKARFEAFGTAGNASRIKVVPMPEMARRYASGSL 349 Lambda K H 0.316 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 359 Length adjustment: 29 Effective length of query: 325 Effective length of database: 330 Effective search space: 107250 Effective search space used: 107250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate SM_b20199 SM_b20199 (fructose-1,6-bisphosphate aldolase)
to HMM TIGR01521 (fba: fructose-bisphosphate aldolase, class II, Calvin cycle subtype (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01521.hmm # target sequence database: /tmp/gapView.1985677.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01521 [M=347] Accession: TIGR01521 Description: FruBisAldo_II_B: fructose-bisphosphate aldolase, class II, Calvin cycle subtype Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-220 715.0 0.6 8.2e-220 714.8 0.6 1.0 1 lcl|FitnessBrowser__Smeli:SM_b20199 SM_b20199 fructose-1,6-bisphosph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SM_b20199 SM_b20199 fructose-1,6-bisphosphate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 714.8 0.6 8.2e-220 8.2e-220 1 347 [] 3 349 .. 3 349 .. 1.00 Alignments for each domain: == domain 1 score: 714.8 bits; conditional E-value: 8.2e-220 TIGR01521 1 lislrqlldhaaergygvpafnvnnleqilaimeaadktdspvilqasrgarsyagevllrklvlaaveeypdi 74 +i+lrqlldhaaer+ygvpafn+nn+eq laimeaa+++d+pvilq+srgarsya++v+l+k+++a++e+ypdi lcl|FitnessBrowser__Smeli:SM_b20199 3 RITLRQLLDHAAERSYGVPAFNINNMEQGLAIMEAARASDAPVILQVSRGARSYANDVMLAKMMEALEEMYPDI 76 69************************************************************************ PP TIGR01521 75 pvvlhqdhgnspatclsaiqlgftsvmmdgslkedaktpadydynvsvtaevvklahavgasvegelgclgsle 148 p+++hqdhgn++atcl+aiq+gftsvmmdgslkedaktpadydynvs+taev++lah+vgasvegelgclgsle lcl|FitnessBrowser__Smeli:SM_b20199 77 PLCIHQDHGNNVATCLTAIQHGFTSVMMDGSLKEDAKTPADYDYNVSITAEVSRLAHMVGASVEGELGCLGSLE 150 ************************************************************************** PP TIGR01521 149 tgkgeaedghgfegaldrsqlltdpeeaaefvkktkvdalavaigtshgaykftrkptgevlaidrieeiherl 222 tg+geaedghgfegaldrsqlltdp+eaa+fv++t+vdalavaigtshgaykftrkptgevla+d+ie+iherl lcl|FitnessBrowser__Smeli:SM_b20199 151 TGHGEAEDGHGFEGALDRSQLLTDPDEAARFVAETGVDALAVAIGTSHGAYKFTRKPTGEVLAMDVIEKIHERL 224 ************************************************************************** PP TIGR01521 223 pdthlvmhgsssvpqewldvineyggeiketygvpveeivkgikfgvrkvnidtdlrlaataalrrvaakdpse 296 pdth+vmhgsssvpqew+dv+n++gg+++etygvpveeiv+gi+fgvrkvnidtdlrlaa+aa+rrva++++se lcl|FitnessBrowser__Smeli:SM_b20199 225 PDTHIVMHGSSSVPQEWQDVFNAHGGQMRETYGVPVEEIVRGIRFGVRKVNIDTDLRLAAAAAFRRVADTSRSE 298 ************************************************************************** PP TIGR01521 297 fdprkflkkaveamkdvckaryeafgtagnaskikvvsleemarryakgel 347 fdprkflk+a++am++vckar+eafgtagnas+ikvv+++emarrya+g+l lcl|FitnessBrowser__Smeli:SM_b20199 299 FDPRKFLKPAMDAMSAVCKARFEAFGTAGNASRIKVVPMPEMARRYASGSL 349 *************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (347 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 16.06 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory