Align UTP--glucose-1-phosphate uridylyltransferase; Alpha-D-glucosyl-1-phosphate uridylyltransferase; General stress protein 33; GSP33; UDP-glucose pyrophosphorylase; UDPGP; Uridine diphosphoglucose pyrophosphorylase; EC 2.7.7.9 (characterized)
to candidate SMc04023 SMc04023 UTP--glucose-1-phosphate uridylyltransferase
Query= SwissProt::Q05852 (292 letters) >FitnessBrowser__Smeli:SMc04023 Length = 295 Score = 276 bits (705), Expect = 5e-79 Identities = 143/289 (49%), Positives = 195/289 (67%), Gaps = 9/289 (3%) Query: 2 KKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSK 61 +KVRKA+ P AGLGTRFLPATKA+PKEML +VDKP IQY+++EA+EAGIE +I VTG+SK Sbjct: 5 RKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGIEHLIFVTGRSK 64 Query: 62 RAIEDHFDYSPELERNLEEKGKT---ELLEKVKKASNLADIHYIRQKEPKGLGHAVWCAR 118 IED+FD EL++ L E+ K ELLE + + + RQ+ P GLGHAVWCAR Sbjct: 65 AVIEDYFDIQVELDQTLRERNKKAEIELLEAMLPKAGTTS--FTRQQAPLGLGHAVWCAR 122 Query: 119 NFIGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTS 178 + +G+EPFA+LL D I++ E L+ +++ YE++ +++ V++ ++ H+YGI+ + Sbjct: 123 DLVGNEPFALLLPDMIMKGEKGCLKGMVELYEESGGNVVAVEECAPDQAHKYGIVGVGET 182 Query: 179 EGRRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLN 238 G +++ VEKP KGTAPSN I GRY+ PEIF LE Q+ GAG EIQLTD + KL Sbjct: 183 VGDGFRITRMVEKPAKGTAPSNFFINGRYILQPEIFPILETQERGAGNEIQLTDGMVKLA 242 Query: 239 EIQRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLL 287 E Q AY F G YD G K GFI + FA++ ++R P +EG L Sbjct: 243 EAQPFAAYHFRGDTYDCGAKDGFILANVAFALERGDIR----PIVEGPL 287 Lambda K H 0.317 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 295 Length adjustment: 26 Effective length of query: 266 Effective length of database: 269 Effective search space: 71554 Effective search space used: 71554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate SMc04023 SMc04023 (UTP--glucose-1-phosphate uridylyltransferase)
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.5624.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-105 337.7 0.0 3.1e-105 337.4 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc04023 SMc04023 UTP--glucose-1-phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc04023 SMc04023 UTP--glucose-1-phosphate uridylyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 337.4 0.0 3.1e-105 3.1e-105 1 260 [. 7 267 .. 7 268 .. 0.99 Alignments for each domain: == domain 1 score: 337.4 bits; conditional E-value: 3.1e-105 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsyeleakl 75 +rkav+P+aGlGtr+LPatka+Pkeml++vdkP+iqyvv+ea+eaGie++++vtgrsk ied+fD+++el+++l lcl|FitnessBrowser__Smeli:SMc04023 7 VRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGIEHLIFVTGRSKAVIEDYFDIQVELDQTL 81 79************************************************************************* PP TIGR01099 76 ekknkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeeealkqlielyekt 149 +++nk+ +++ ++++ ++ t ++rq+ GLGhav++a++lvg+epfa ll+D +++ e+ +lk ++elye+ lcl|FitnessBrowser__Smeli:SMc04023 82 RERNKKAEIELLEAMLPKaGTTSFTRQQAPLGLGHAVWCARDLVGNEPFALLLPDMIMKGEKGCLKGMVELYEES 156 ****************9967899**************************************************** PP TIGR01099 150 gasiiaveevpkeevskYGvidgeeveeelyevkdlvekPkpeeapsnlaivGrYvltpeifelleetkaGkgge 224 g +++avee + ++ +kYG++ + e+ + ++++ +vekP + +apsn+ i GrY+l+peif +le++++G+g+e lcl|FitnessBrowser__Smeli:SMc04023 157 GGNVVAVEECAPDQAHKYGIVGVGETVGDGFRITRMVEKPAKGTAPSNFFINGRYILQPEIFPILETQERGAGNE 231 *************************************************************************** PP TIGR01099 225 iqltDalrlllekeevlavklkgkryDvGdklgylk 260 iqltD++ +l+e++ + a++++g +yD+G k g++ lcl|FitnessBrowser__Smeli:SMc04023 232 IQLTDGMVKLAEAQPFAAYHFRGDTYDCGAKDGFIL 267 **********************************85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (295 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.21 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory