Align ABC transporter permease (characterized, see rationale)
to candidate SM_b21149 SM_b21149 sugar uptake ABC transporter permease
Query= uniprot:A0A166QFV1 (320 letters) >FitnessBrowser__Smeli:SM_b21149 Length = 294 Score = 181 bits (460), Expect = 1e-50 Identities = 95/296 (32%), Positives = 166/296 (56%), Gaps = 13/296 (4%) Query: 21 VQRRRVRAAWLFLTPMLLCLALVAAWPLLRTFWFSLTDANLADTGGGTFIGFGNYLFHNG 80 V+R + AW+ L P + + ++ A+PL+ TF S TDA+L T ++G NY Sbjct: 3 VRRSTIIFAWVLLLPAVFYVTVIVAYPLVDTFVLSFTDASLKKTT--KWVGTANYDKIFN 60 Query: 81 SSWSGILVDPQWWNAVRNTLYFTVVSVGLEVVLGLLVALLLNIKFTGRALVRALILIPWA 140 ++++ +++ T +T SV +++++G A++LN GRAL R L + PW Sbjct: 61 ATFAEVIL---------RTFVWTAFSVTIKMIIGTFGAVMLNAAVPGRALFRVLTMPPWI 111 Query: 141 IPTIVSAKIWSWMLNDQFGIINHLMLSLGLIDAPLAWTADADLSMWAVIIVDVWKTVPFV 200 +P + +W WM N QFG+I+ + + GL+D P+A+ A + WA I+ DVW VP V Sbjct: 112 VPMAIGIFMWGWMYNGQFGMISGTLQNWGLVDGPVAFLAHGSTAFWATIVTDVWIGVPLV 171 Query: 201 TLLMLAALQMLPSDCYEAARVDGIHPLKVFWRVTLPLLMPALLVAAIFRILDSLRVFDVI 260 TL MLA++Q +P D YEAA DG F R+TLPLL+P+++ ++ ++ + FD+I Sbjct: 172 TLYMLASMQAIPQDLYEAAWTDGAGRFYRFRRITLPLLVPSMITMSMLSLIATFNSFDII 231 Query: 261 YVLTSN--SSSTMSMSVYARQHLVEFQDVGYGSAASTLLFLVVAVIALLYLYLGRR 314 ++LT + T +M + + + + G G+A + L+ + +++ + Y + R Sbjct: 232 WILTQGGPNGDTTTMIIDTYRTAIGSKKYGEGAARAVLICIFLSIFCIAYFRVTHR 287 Lambda K H 0.329 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 294 Length adjustment: 27 Effective length of query: 293 Effective length of database: 267 Effective search space: 78231 Effective search space used: 78231 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory