Align D-lactate dehydrogenase (acceptor) (EC 1.1.99.6) (characterized)
to candidate SMc00832 SMc00832 glycolate oxidase subunit protein
Query= BRENDA::O29853 (443 letters) >FitnessBrowser__Smeli:SMc00832 Length = 479 Score = 216 bits (550), Expect = 1e-60 Identities = 147/435 (33%), Positives = 231/435 (53%), Gaps = 28/435 (6%) Query: 24 ETPPLVAPRAAENFVVVKPSNSEEVSAILKFANEKSIPVFMRGGGTGLSGGAVPTEEGIV 83 ET +A R VV P +E V+A+LK+ + IP+ RG GT LSGGA+P E+ IV Sbjct: 45 ETDAFIAYRRMP-LAVVLPETTEHVAAVLKYCSRYGIPIVPRGAGTSLSGGAIPQEDAIV 103 Query: 84 LSTEKMTE-LEVDADNRVAICGAGVTLKQLDDAAFRHGLSFPPHPGAETA-TVGGMIATN 141 + KM+ L++D NR A AGVT + DA G + P P ++ A T+GG I N Sbjct: 104 VGLSKMSRTLDIDLFNRTATVQAGVTNLNISDAVSADGFFYAPDPSSQLACTIGGNIGMN 163 Query: 142 AGGVRALKYGTMRNYVLSLEAVLADGRIINVGGKTIKNSSGYSLLHLLVGSEGTLAVITK 201 +GG LKYG N +L ++ VL DG +I +GGK + ++ GY LL L+ GSEG L ++T+ Sbjct: 164 SGGAHCLKYGVTTNNLLGVKMVLFDGTVIELGGKAL-DAPGYDLLGLVCGSEGQLGIVTE 222 Query: 202 ATIRLFPQMRDMTVLAIPFPTMEDAMNCVVE-VARKMLPMALEFMEKRAVEIGEKVSGER 260 AT+RL + + F + E A +CV + + ++P+A+EFM++ A+EI E + + Sbjct: 223 ATVRLIAKPEGARPVLFGFASSESAGSCVADIIGSGIIPVAIEFMDRPAIEICEAFA-QA 281 Query: 261 WVSREGEAHLLMVFESFDEAEEAAKIAQSLGAIDVYAATTKKDQDRLLKVRGMIYEGLRK 320 + EA L++ E EAE A +A + + T ++ L+ +I++G RK Sbjct: 282 GYPLDVEALLIVEVEG-SEAEMDATLAGIIEIARRHGVMTIRESQSALEA-ALIWKG-RK 338 Query: 321 EVIEV---------LDACVPPAKIAEYWRRSNELAEEYGIELITYGHAGDGNVHQHPLVY 371 +D VP ++++ RR+ E+ YG+ + HAGDGN+ HPL+ Sbjct: 339 SAFGATGRIADYICMDGTVPLSQLSHVLRRTGEIVAGYGLRVANVFHAGDGNM--HPLIL 396 Query: 372 EGWEKSYFEFR-----KSLLSLAVSLGGVISGEHGIGAVKLSELEELFPEQFELMRQI-- 424 R +L L V GG ++GEHG+G K + + + +L +Q+ Sbjct: 397 YNINDPEEAARAEAAGNDILKLCVEAGGCLTGEHGVGIEKRDLMLHQY-SRADLGQQMAA 455 Query: 425 KLLFDPKNILNPGKV 439 + FDP+ ++NP KV Sbjct: 456 RAAFDPQWLMNPSKV 470 Lambda K H 0.317 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 28 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 479 Length adjustment: 33 Effective length of query: 410 Effective length of database: 446 Effective search space: 182860 Effective search space used: 182860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory