Align Aminomethyltransferase (EC 2.1.2.10) (characterized)
to candidate SMc02047 SMc02047 glycine cleavage system aminomethyltransferase T
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1866 (374 letters) >FitnessBrowser__Smeli:SMc02047 Length = 379 Score = 416 bits (1068), Expect = e-121 Identities = 221/375 (58%), Positives = 265/375 (70%), Gaps = 9/375 (2%) Query: 6 LLKTPLHALHIELGARMVPFAGYDMPVQYPLGVMKEHQHTRDQAGLFDVSHMGQIRLTGA 65 L TPLHALH+ LGARMVPFAGYDMPVQYP GV+KEH HTR AGLFDVSHMGQI + Sbjct: 7 LKHTPLHALHLSLGARMVPFAGYDMPVQYPEGVLKEHLHTRAAAGLFDVSHMGQIVVRPK 66 Query: 66 N-----AAKALETLVPVDIIDLPVGMQRYAMFTNATGGILDDLMVANLGNDELFLVVNAA 120 + AA ALE LVP D++ L G QRY +FTNA GGILDDLM+ N G D LFLVVNAA Sbjct: 67 SGKIEDAALALEKLVPADVLGLAEGRQRYGLFTNAAGGILDDLMIVNRG-DHLFLVVNAA 125 Query: 121 CKDQDLAHLRKHIGDQCTIEPLFEERALLALQGPAAVTVLARLAPEVAKMTFMQFARVKL 180 CKD DLAHL+ +G C + L +RAL+ALQGP A VL L +V+ M FM L Sbjct: 126 CKDADLAHLKDGLGSVCDVTML-TDRALIALQGPRAGAVLCELWADVSSMRFMDVTEADL 184 Query: 181 LGVDCFVSRSGYTGEDGFEISVPATNAEALARALLAEAEVAAIGLGARDSLRLEAGLCLY 240 V C +SRSGYTGEDGFEIS+PA A + + LL +V IGLGARDSLRLEAGLCLY Sbjct: 185 HDVSCIISRSGYTGEDGFEISIPAEAAVDVTQRLLEHPDVLPIGLGARDSLRLEAGLCLY 244 Query: 241 GHDMNTDTTPIEASLLWAISKPRRADGARAGGFPGAETVFAQQQAGVSRKRVGLLPQERT 300 G+D++T+T+PIEA L WAI K RRA G RAGGFPGA + A+ GVSR+RVGL P+ R Sbjct: 245 GNDIDTNTSPIEAGLEWAIQKSRRAGGERAGGFPGAGRILAELTDGVSRRRVGLRPEGRA 304 Query: 301 PVREGAEIV--NEAGDIIGSVCSGGFGPTLGGPLAMGYVDSAYIALDTPVWAIVRGKKVP 358 PVR A + E G+V SGGFGP++ GP+AMGYVD+ + + T ++A VRGK +P Sbjct: 305 PVRGNANLFADEEGRTAAGTVTSGGFGPSVDGPVAMGYVDAEHAEVGTRLFAEVRGKYLP 364 Query: 359 LLVSKMPFVPQRYYR 373 + V+ +PF+ Q Y R Sbjct: 365 IAVTALPFIKQTYKR 379 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 379 Length adjustment: 30 Effective length of query: 344 Effective length of database: 349 Effective search space: 120056 Effective search space used: 120056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate SMc02047 SMc02047 (glycine cleavage system aminomethyltransferase T)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.1835499.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-104 333.1 0.0 1.1e-103 332.9 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc02047 SMc02047 glycine cleavage system Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc02047 SMc02047 glycine cleavage system aminomethyltransferase T # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 332.9 0.0 1.1e-103 1.1e-103 1 361 [. 7 374 .. 7 375 .. 0.94 Alignments for each domain: == domain 1 score: 332.9 bits; conditional E-value: 1.1e-103 TIGR00528 1 lkrtpLydlhtelggklvdfaGwelPvqy.kslieeheavrtkaGlfDvshmgkvels...Gs..kslkfLqrll 69 lk+tpL+ lh +lg+++v+faG+ +Pvqy +++ +eh +r +aGlfDvshmg++ ++ G+ ++ +L++l+ lcl|FitnessBrowser__Smeli:SMc02047 7 LKHTPLHALHLSLGARMVPFAGYDMPVQYpEGVLKEHLHTRAAAGLFDVSHMGQIVVRpksGKieDAALALEKLV 81 689**************************5588***********************972224322567789**** PP TIGR00528 70 anDvdaLtkGkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkehleeevtldtlskeisll 144 ++Dv L++G+ +y + na GG++DDl++ ++g+ + lvvnaa+++ Dl++lk+ l ++ l+ + +l+ lcl|FitnessBrowser__Smeli:SMc02047 82 PADVLGLAEGRQRYGLFTNAAGGILDDLMIVNRGDH--LFLVVNAACKDADLAHLKDGLGSVCDVTMLT-DRALI 153 **********************************99..99*******************9999887665.579** PP TIGR00528 145 alqGPkaktiledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekavelwkklveaygvkP 219 alqGP+a ++l +l ++v++++ f+ v ea+l ++i+r+GytGedGfei+++ e av++ ++l+e++ v P lcl|FitnessBrowser__Smeli:SMc02047 154 ALQGPRAGAVLCELW-ADVSSMR-FMDVTEADLHDVSCIISRSGYTGEDGFEISIPAEAAVDVTQRLLEHPDVLP 226 *************97.6899996.77788****9999************************************** PP TIGR00528 220 iGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkker.....kksdfiGravleeqkengtekklvGleml 289 iGLgarD+Lrleag++LyG+++d +++P+eagl+w+++k+r + f G + +g+ +++vGl+ lcl|FitnessBrowser__Smeli:SMc02047 227 IGLGARDSLRLEAGLCLYGNDIDTNTSPIEAGLEWAIQKSRraggeRAGGFPGAGRILAELTDGVSRRRVGLRPE 301 ****************************************9999888899************************* PP TIGR00528 290 ekgiarnelkvllt.ngekevGivtsGtlsPtLgknialayvdkelekiGtklevevrnklvkikvvkklfvr 361 + r + +++ +g + G vtsG + P ++ +a++yvd e +++Gt+l evr+k ++i v+ +f++ lcl|FitnessBrowser__Smeli:SMc02047 302 GRAPVRGNANLFADeEGRTAAGTVTSGGFGPSVDGPVAMGYVDAEHAEVGTRLFAEVRGKYLPIAVTALPFIK 374 ***99*****99987999***************************************************9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 28.30 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory