Align lactoylglutathione lyase (EC 4.4.1.5) (characterized)
to candidate SMa0374 SMa0374 dioxygenase/lyase
Query= BRENDA::Q9CJC0 (389 letters) >FitnessBrowser__Smeli:SMa0374 Length = 310 Score = 139 bits (349), Expect = 1e-37 Identities = 94/276 (34%), Positives = 133/276 (48%), Gaps = 9/276 (3%) Query: 19 GVHHVTAITSSAQKIYDFFTNILGLRLAKLTVNQDDYETYHLFFTEEDGH-GADMTFFDF 77 G+HHVT++ S A++ FFT+ LGLR K TVN DD YHL++ +E G G MT+F F Sbjct: 7 GLHHVTSMASDARQNNRFFTDTLGLRRVKQTVNFDDPSVYHLYYGDETGSAGTVMTYFPF 66 Query: 78 KDIPKGNHGVNNIERASFRVPTDASLDYWTRRFDNAHVKHGEISSKFGQKTLEFEDFDGQ 137 ++ G GV + F VP SL +W RF V E + FG L F DG Sbjct: 67 PNMMLGRPGVGEVGETQFSVP-KGSLKFWQDRFTTQGVDGLERDTVFGADRLRFMGPDGD 125 Query: 138 LYQLISDQNNSGDDSKGRSWQLSNVPQEHGITGLGPVFVKVENAENLRTILETVFGFRYA 197 + LI D K W +P + I G + ++ +L G+ A Sbjct: 126 SFALIESA-----DDKRAPWLADGIPDDAAIRGFAGARFSLHDSAATEELL-GFMGYERA 179 Query: 198 GQEDDLHLFEVANGGNGAALILQEAGEKEAYAYQGYGTIHHLALGTANPETLNYWIERIK 257 +E D+ F ++N GNGA I A K +A QG G++HH+A N E + + Sbjct: 180 EKEGDVVRFIISN-GNGADTIDLLALPKTPFARQGAGSVHHIAFAVDNREKQLEVRKALM 238 Query: 258 AFRLPHSGLVDRFYFSSEYVRVAPGVLFEIATYTPG 293 + ++DR YF + Y R G+LFE+AT PG Sbjct: 239 DTGYQVTPVIDRDYFWAIYFRTPGGILFEVATNEPG 274 Lambda K H 0.316 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 310 Length adjustment: 29 Effective length of query: 360 Effective length of database: 281 Effective search space: 101160 Effective search space used: 101160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory