Align Hydroxyacylglutathione hydrolase; EC 3.1.2.6; Glyoxalase II; Glx II (uncharacterized)
to candidate SMc00708 SMc00708 hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II) protein
Query= curated2:Q8U9W1 (256 letters) >FitnessBrowser__Smeli:SMc00708 Length = 256 Score = 352 bits (902), Expect = e-102 Identities = 167/256 (65%), Positives = 200/256 (78%) Query: 1 MKPLEIDVFLCRSDNFGVLLHDPESGATAAIDAPEEGPILRALDGHGWKLTHIFTTHHHQ 60 M LE+D+FLCR+DN+GVLLHD SGATA+IDAPEE PIL AL+ GW+LTHI TTHHH Sbjct: 1 MAALELDLFLCRTDNYGVLLHDRLSGATASIDAPEERPILDALERRGWQLTHILTTHHHG 60 Query: 61 DHVEANLVLKDKFRCEVHGPYDEAIAIPGLDRSQADGDEFEFAGRRVQVIATPGHTAGHI 120 DHV AN LK++F + GP +EA IPG+DR+ GD F+FAG V VI TPGHT+GH+ Sbjct: 61 DHVAANASLKERFGLTIIGPKNEASKIPGIDRTVGHGDRFDFAGHPVDVIETPGHTSGHV 120 Query: 121 CYYLPDDGLLFAADTLFAMGCGRLFERPAADMWHSFQKLMALPDDTRVYFGHEYTLSNAR 180 CY+LP+D LLFAADTLFA+GCGRLFE A MW S +LMALPDDT +YFGHEYTL+NA Sbjct: 121 CYHLPEDKLLFAADTLFALGCGRLFEGTADTMWQSLSRLMALPDDTAIYFGHEYTLANAH 180 Query: 181 FALTVDPDNAVLRERAARVETARQANEFTIPTTIGLEKQTNPYMRVADAGIRRHLGLEGA 240 FA+TVDP+N+ L+ERAA +E R FT PTT+GLEK+TNP++R D IR LG+E A Sbjct: 181 FAITVDPENSALKERAAEIEETRSDGGFTAPTTMGLEKRTNPFLRAGDPKIRALLGMEKA 240 Query: 241 ADADVFAEIRTRKDNF 256 +DA VFAEIR RKDNF Sbjct: 241 SDAAVFAEIRKRKDNF 256 Lambda K H 0.323 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 256 Length adjustment: 24 Effective length of query: 232 Effective length of database: 232 Effective search space: 53824 Effective search space used: 53824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate SMc00708 SMc00708 (hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II) protein)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.3583.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-100 321.1 0.0 2.5e-100 320.9 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc00708 SMc00708 hydroxyacylglutathione Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc00708 SMc00708 hydroxyacylglutathione hydrolase (glyoxalase II) (GLX II) protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 320.9 0.0 2.5e-100 2.5e-100 5 248 .] 10 256 .] 6 256 .] 0.99 Alignments for each domain: == domain 1 score: 320.9 bits; conditional E-value: 2.5e-100 TIGR03413 5 palsdNyiwllkdeks.eavvvDpgeaepvlealeekglkleaillTHhHaDHvggvaellekfpvkvvgpaee. 77 + +dNy +ll+d+ s +++ +D++e++p+l+ale++g++l++il+THhH DHv ++a+l+e+f+++++gp++e lcl|FitnessBrowser__Smeli:SMc00708 10 LCRTDNYGVLLHDRLSgATASIDAPEERPILDALERRGWQLTHILTTHHHGDHVAANASLKERFGLTIIGPKNEa 84 6889**********999********************************************************99 PP TIGR03413 78 .ripgltkevkegdevellelevevlevpGHtlgHiayyleeekvlFcgDtLfsaGCGrlfegtaeqmleslqkl 151 +ipg++++v +gd+++++++ v+v+e+pGHt+gH++y+l+e+k+lF++DtLf++GCGrlfegta++m++sl++l lcl|FitnessBrowser__Smeli:SMc00708 85 sKIPGIDRTVGHGDRFDFAGHPVDVIETPGHTSGHVCYHLPEDKLLFAADTLFALGCGRLFEGTADTMWQSLSRL 159 9************************************************************************** PP TIGR03413 152 aaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrakgkptlPstlaeekatNpFLraeeaevkaa 226 aLp++t++y +HEYtl+N++Fa++v+pen+alker++e+e++r++g t P+t++ ek+tNpFLra +++++a lcl|FitnessBrowser__Smeli:SMc00708 160 MALPDDTAIYFGHEYTLANAHFAITVDPENSALKERAAEIEETRSDGGFTAPTTMGLEKRTNPFLRAGDPKIRAL 234 *************************************************************************** PP TIGR03413 227 leeekaeevevfaelRekkdkf 248 l++eka++++vfae+R++kd+f lcl|FitnessBrowser__Smeli:SMc00708 235 LGMEKASDAAVFAEIRKRKDNF 256 ********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (256 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.78 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory