Align palmitoyl-CoA hydrolase (EC 3.1.2.2) (characterized)
to candidate SMc01273 SMc01273 S-formylglutathione hydrolase
Query= BRENDA::P33018 (278 letters) >FitnessBrowser__Smeli:SMc01273 Length = 277 Score = 270 bits (689), Expect = 3e-77 Identities = 136/278 (48%), Positives = 185/278 (66%), Gaps = 4/278 (1%) Query: 1 MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDHTPPPVLYWLSGLTCNDENFT 60 M+++ ++ F G Q + HDS+ MTF++F+PP P PVL++LSGLTC N Sbjct: 1 MKVISQNTAFGGMQGVYAHDSTACKGEMTFAVFVPPQAITEPRPVLWYLSGLTCTHANVM 60 Query: 61 TKAGAQRVAAELGIVLVMPDTSPRGEKVAND-DGYDLGQGAGFYLNATQPPWATHYRMYD 119 K +R+A+ELG+++V PDTSPRG V ++ + +G+GAGFYL+AT+ PWA HYRMY Sbjct: 61 EKGEYRRMASELGLIIVCPDTSPRGADVPDELTNWQMGKGAGFYLDATEKPWAEHYRMYS 120 Query: 120 YLRDELPALVQSQFNVS-DRCAISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCSVP 178 Y+ +ELPALV F V R I GHSMGGHGA+ +ALK+P ++ S SAFAPIV P S Sbjct: 121 YITEELPALVGQHFRVDMGRQGIFGHSMGGHGAMTVALKHPERFKSCSAFAPIVAPSSAD 180 Query: 179 WGIKAFSSYLGEDKNAWLEWDSCALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLAEA 238 W + AF YLG DK AW E+D+CAL+ + LIDQG D FL + L+P + EA Sbjct: 181 WSVGAFEKYLGPDKAAWREYDACALV--EDGARFPEFLIDQGKADSFLENGLRPWLFEEA 238 Query: 239 ARQKAWPMTLRIQPGYDHSYYFIASFIEDHLRFHAQYL 276 + +TLR+ YDHSYYFI++F++DHLR+HA+ L Sbjct: 239 VKGTDIGLTLRMHERYDHSYYFISTFMDDHLRWHAERL 276 Lambda K H 0.320 0.136 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 277 Length adjustment: 25 Effective length of query: 253 Effective length of database: 252 Effective search space: 63756 Effective search space used: 63756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory