Align 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase; AONS/AKB ligase; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; Alpha-oxoamine synthase; Glycine acetyltransferase; EC 2.3.1.29; EC 2.3.1.47 (characterized)
to candidate SMc02272 SMc02272 acyl-transferase transferase
Query= SwissProt::Q5SHZ8 (395 letters) >FitnessBrowser__Smeli:SMc02272 Length = 471 Score = 222 bits (565), Expect = 2e-62 Identities = 122/348 (35%), Positives = 194/348 (55%), Gaps = 2/348 (0%) Query: 36 TRVEGREVVNLASNNYLGFANHPYLKEKARQYLEKWGAGSGAVRTIAGTFTYHVELEEAL 95 T ++GR+++N AS +YLG H ++ E+AR+ + +G + A R +AG HVELEE + Sbjct: 92 TMIDGRKLINFASYDYLGLNRHAHVLERARETIADFGISASASRLVAGERPQHVELEEKI 151 Query: 96 ARFKGTESALVLQSGFTANQGVLGALLKEGDVVFSDELNHASIIDGLRLTKATRLVFRHA 155 A+F G ++A+ SG+ N + L+ D+V DE H S + G++L+ ATR F+H Sbjct: 152 AQFYGVDAAVCFVSGYLTNVAAISCLMGPKDLVIHDEFIHNSALAGIKLSGATRRFFKHN 211 Query: 156 DVAHLEELLKAHDTDGLK-LIVTDGVFSMDGDIAPLDKIVPLAKKYKAVVYVDDAHGSGV 214 D A LE +L+ D + L++ +G++SMDGD+A L ++ L +Y + VD+AH GV Sbjct: 212 DTADLEHVLRTVAGDYRRILVIVEGIYSMDGDVANLPALLKLRAEYGFWLMVDEAHSLGV 271 Query: 215 LGEKGKGTVHHFGFHQDPDVVQVATLSKAWAGIGGYAAGARELKDLLINKARPFLFSTSH 274 LG G+G HFG + + TLSK + GGY AG+ L +L A F++S Sbjct: 272 LGRHGRGLAEHFGADPHEVDIWMGTLSKTTSSCGGYIAGSAALAAVLKASAGGFVYSVGL 331 Query: 275 PPAVVGALLGALELIEKEPERVERLWENTRYFKRELARLGYDT-LGSQTPITPVLFGEAP 333 P + + + +L+++ EPER + N F + G DT L + PV+ G++ Sbjct: 332 APVLAASAVASLDILASEPERTAAVRRNGSLFLKLAKEAGLDTGLSGGFSVVPVIVGDSL 391 Query: 334 LAFEASRLLLEEGVFAVGIGFPTVPRGKARIRNIVTAAHTKEMLDKAL 381 A + S LL GV + I P VP G+AR+R +T HT+E + + + Sbjct: 392 RAVQLSNDLLAAGVNVLPIIHPAVPEGQARLRFFITCDHTEEQIRRTV 439 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 471 Length adjustment: 32 Effective length of query: 363 Effective length of database: 439 Effective search space: 159357 Effective search space used: 159357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory