Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.110) (characterized)
to candidate SMc01455 SMc01455 D-lactate dehydrogenase (cytochrome) protein
Query= BRENDA::H6LBS1 (466 letters) >FitnessBrowser__Smeli:SMc01455 Length = 468 Score = 219 bits (558), Expect = 2e-61 Identities = 145/458 (31%), Positives = 236/458 (51%), Gaps = 19/458 (4%) Query: 18 IPAERVFVGTEIGEDFSHDE-LGSIHS---------YPEVLIKVTSTEEVSKIMKYAYEH 67 I A + ++ T G+ F E + + H+ P+ ++ S EV +I++ A EH Sbjct: 16 IAAAKTYLATRFGDRFQTGEAIRAQHANTTTYIPAQLPDAVVFPESAAEVREIVEIACEH 75 Query: 68 NIPVVVRGSGTGLVGACVPLFGGIMLETTLMNNILELDTENLTVTVEPGVLLMELSKFVE 127 +P++ G+G+ L G GGI ++ MN +L ++ E+L TVEPGV EL+ ++ Sbjct: 76 RVPLIPFGTGSSLEGHVNAPHGGISVDMMRMNRVLAVNAEDLDCTVEPGVTREELNSYLR 135 Query: 128 ENDLFYPPDPGEKSATIAGNISTNAGGMRAVKYGVTRDYVRGLTVVLANGEIIELGGKIV 187 + LF+P DPG +A+I G ST A G AV+YG ++ V +T V+A G I + Sbjct: 136 DTGLFFPIDPGA-NASIGGMASTRASGTNAVRYGTMKENVLAVTAVVAGGREIRTAHRAR 194 Query: 188 KNSSGYSLKDLVIGSEGTLCVITKAILKLLPLPKMTLSLLIPFENISDAAGIVPKIIKSK 247 K+S+GY L L +G+EGTL ++T L+L +P++ + PF I+DA V I+S Sbjct: 195 KSSAGYDLTRLFVGAEGTLGIVTSITLRLQGIPEVISGGVCPFPTIADACNAVILTIQSG 254 Query: 248 AIPTAIEFMERQTILFAEDFLGKKFPDSSSNAYILLTFDGNTKEQVEAEYETVANLCLAE 307 IE ++ + + G + ++ + + + F GN E VE + A + Sbjct: 255 IPVARIELLDALQMKACNAYSGLTYQETPT---LFVEFHGN-GESVELQSRQFAEIASEF 310 Query: 308 GAKDVYIVDTVERKDSVWSARGAFLEAIKA--STTEMDECDVVVPRNRIAEFIEFTHDLA 365 G+ E + +W AR A K+ + DV VP +R+A+ + TH+ Sbjct: 311 GSTGFIWTTNPEERARLWKARHNAYWAQKSLMPGRAILSTDVCVPISRLADCVAATHEDI 370 Query: 366 KEMDVRIPSFGHAGDGNLHIYVCRDELCQADWEAKLAEAMDRMYAKALTFEGLVSGEHGI 425 + P GHAGDGN H+ + D+ AD A+ ++R+ A+AL+ +G +GEHGI Sbjct: 371 AAHGLVAPIVGHAGDGNFHVGLLFDDKDAAD-VAQAEAFVERLNARALSMDGTCTGEHGI 429 Query: 426 GYAKRKYLLNDFGTEHLALMAGIKQTFDPKNLLNPKKV 463 G K +L + G + L LM IK++ DP N+ NP K+ Sbjct: 430 GQGKMPFLAAELG-DALDLMRQIKRSLDPDNIFNPGKI 466 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 468 Length adjustment: 33 Effective length of query: 433 Effective length of database: 435 Effective search space: 188355 Effective search space used: 188355 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory