GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lpd in Sinorhizobium meliloti 1021

Align dihydrolipoyl dehydrogenase (EC 1.8.1.4) (characterized)
to candidate SMc01035 SMc01035 dihydrolipoamide dehydrogenase

Query= BRENDA::P50970
         (466 letters)



>lcl|FitnessBrowser__Smeli:SMc01035 SMc01035 dihydrolipoamide
           dehydrogenase
          Length = 481

 Score =  513 bits (1321), Expect = e-150
 Identities = 264/480 (55%), Positives = 334/480 (69%), Gaps = 15/480 (3%)

Query: 1   MADHFDLIVLGGGPGGYVAAIRAAQLNLKVALVERVHLGGICLNWGCIPTKSLLRSAEVY 60
           MA+++D+IV+G GPGGYV AIR+AQL LK A+VER HLGGICLNWGCIPTK+LLRSAE+ 
Sbjct: 1   MAENYDVIVVGSGPGGYVTAIRSAQLGLKTAIVEREHLGGICLNWGCIPTKALLRSAEIL 60

Query: 61  HEMQNAEAYGLT-SFKPDFDLDKIIARSREVATRLASGVKTLLRKNKVEVISGVGQLTGN 119
               +A+ YGLT   K   ++  ++ARSR V+ RL  GV  L++KNKV+VI G  +LT  
Sbjct: 61  DHANHAKNYGLTLEGKITANVKDVVARSRGVSARLNGGVAFLMKKNKVDVIWGEAKLTKP 120

Query: 120 QQMLVETTEGE--------------EKILEAKDIIIATGARARQLPNVHSDGKHIWTYHH 165
            +++V                    E    AK II+ATGAR R LP +  DGK IWTY  
Sbjct: 121 GEIVVGAPSKPAVQPQNPVPKGVKGEGTYTAKHIIVATGARPRALPGIEPDGKLIWTYFE 180

Query: 166 ALKPPAMPKKLLVIGSGAIGIEFASFYADFGAEVSIVEHAPQILPMEDAEVSAYVAKAFK 225
           A+KP   PK LLV+GSGAIGIEFASFY   G +V++VE  PQI+P+EDAE+SA+  K  +
Sbjct: 181 AMKPEEFPKSLLVMGSGAIGIEFASFYRSMGVDVTVVELLPQIMPVEDAEISAFARKQLE 240

Query: 226 KRGIRILTQSALQNLTPDDEGVTAEIAGADGKVTKERFSHAIVAIGVVANVENIGLDKLG 285
           KRG++I+T + +  +      VTA +   DGKVT  +    I A+GV  N+EN+GL+ LG
Sbjct: 241 KRGLKIITDAKVTKVEKGANDVTAHVETKDGKVTPIKADRLISAVGVQGNIENLGLEALG 300

Query: 286 IKLDRGFIAVDGFGRTNVDHVWAIGDVAGAPCLAHKASHQGVIAAEAIAGCDHVHPLNTQ 345
           +K DRG I  DG+G+TNV  ++AIGDVAG P LAHKA H+GVI  E IAG   VH L+  
Sbjct: 301 VKTDRGCIVTDGYGKTNVAGIYAIGDVAGPPMLAHKAEHEGVICVEKIAGVPGVHALDKG 360

Query: 346 NIPGCTYARPQVASVGLTEEKARQQGYNVKIGNFPFIANGKAIAQGATDGFVKTVFDADS 405
            IPGCTY  PQVASVGLTE KA++ G ++++G + F ANGKAIA G   G +KT+FD  +
Sbjct: 361 KIPGCTYCDPQVASVGLTEAKAKELGRDIRVGRYSFGANGKAIALGEDQGLIKTIFDKKT 420

Query: 406 GALLGAHMVGAEVTEMIQGYTVARTLETTEAEIMETIFPHPTLSEAMHESVLAAYGRALH 465
           G L+GAHMVGAEVTE+IQG+ VA  LETTE E+M T+FPHPTLSE M ESVL AYGR L+
Sbjct: 421 GELIGAHMVGAEVTELIQGFVVAMNLETTEEELMHTVFPHPTLSEMMKESVLDAYGRVLN 480


Lambda     K      H
   0.319    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 721
Number of extensions: 31
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 466
Length of database: 481
Length adjustment: 33
Effective length of query: 433
Effective length of database: 448
Effective search space:   193984
Effective search space used:   193984
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate SMc01035 SMc01035 (dihydrolipoamide dehydrogenase)
to HMM TIGR01350 (lpdA: dihydrolipoyl dehydrogenase (EC 1.8.1.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01350.hmm
# target sequence database:        /tmp/gapView.3784.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01350  [M=461]
Accession:   TIGR01350
Description: lipoamide_DH: dihydrolipoyl dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   2.9e-180  585.8   6.6   3.3e-180  585.6   6.6    1.0  1  lcl|FitnessBrowser__Smeli:SMc01035  SMc01035 dihydrolipoamide dehydr


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Smeli:SMc01035  SMc01035 dihydrolipoamide dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  585.6   6.6  3.3e-180  3.3e-180       1     459 [.       4     479 ..       4     481 .] 0.97

  Alignments for each domain:
  == domain 1  score: 585.6 bits;  conditional E-value: 3.3e-180
                           TIGR01350   1 eydvvviGgGpgGYvaAiraaqlglkvalvekeklGGtClnvGCiPtKalLksaevveelkeakelgieven.vk 74 
                                         +ydv+v+G+GpgGYv+Air+aqlglk+a+ve+e+lGG+Cln+GCiPtKalL+sae+++++++ak++g+++e+ ++
  lcl|FitnessBrowser__Smeli:SMc01035   4 NYDVIVVGSGPGGYVTAIRSAQLGLKTAIVEREHLGGICLNWGCIPTKALLRSAEILDHANHAKNYGLTLEGkIT 78 
                                         69*******************************************************************9999** PP

                           TIGR01350  75 ldlekllerkekvvkklvgGvkaLlkknkvevikGeaklldkkevevkkekke...............kkleakn 134
                                          +++++++r++ v+ +l+gGv++L+kknkv+vi+Geakl++++e+ v + +k                 +++ak+
  lcl|FitnessBrowser__Smeli:SMc01035  79 ANVKDVVARSRGVSARLNGGVAFLMKKNKVDVIWGEAKLTKPGEIVVGAPSKPavqpqnpvpkgvkgeGTYTAKH 153
                                         ***********************************************8877556889999999998878899*** PP

                           TIGR01350 135 iiiAtGseprelplkleedekvvitseealelkevpeslvivGgGviGvEfasifaklGvkvtvielldrilpal 209
                                         ii+AtG++pr+lp+ +e d+k+++t+ ea++ +e+p+sl+++G+G+iG+Efas+++++Gv+vtv+ell++i+p++
  lcl|FitnessBrowser__Smeli:SMc01035 154 IIVATGARPRALPG-IEPDGKLIWTYFEAMKPEEFPKSLLVMGSGAIGIEFASFYRSMGVDVTVVELLPQIMPVE 227
                                         **************.************************************************************ PP

                           TIGR01350 210 daevskvlkkklkkkgvkiltnakvtevekeedevv..veakkkevetleaekvLvavGrkpnleelgleklgve 282
                                         dae+s +++k+l+k+g+ki+t+akvt+vek +++v+  ve+k+++v+ ++a++++ avG++ n+e+lgle+lgv+
  lcl|FitnessBrowser__Smeli:SMc01035 228 DAEISAFARKQLEKRGLKIITDAKVTKVEKGANDVTahVETKDGKVTPIKADRLISAVGVQGNIENLGLEALGVK 302
                                         ************************************888888889****************************** PP

                           TIGR01350 283 ldergaikvdeelrtnvpgiyaiGDvigklmLAhvAskegvvaaekiagkeks.eidykavPsviytePevasvG 356
                                         +d+ g+i++d + +tnv+giyaiGDv+g++mLAh+A++egv+++ekiag     ++d+ ++P ++y++P+vasvG
  lcl|FitnessBrowser__Smeli:SMc01035 303 TDR-GCIVTDGYGKTNVAGIYAIGDVAGPPMLAHKAEHEGVICVEKIAGVPGVhALDKGKIPGCTYCDPQVASVG 376
                                         776.*********************************************9988799******************* PP

                           TIGR01350 357 lteeqakeegievkvgkfpfaangkalaleetdGfvkvivdkktgeilGahivgaeaseliselalaveleltve 431
                                         lte++ake g +++vg+++f angka+al+e++G++k+i+dkktge++Gah+vgae++eli+ +++a++le+t+e
  lcl|FitnessBrowser__Smeli:SMc01035 377 LTEAKAKELGRDIRVGRYSFGANGKAIALGEDQGLIKTIFDKKTGELIGAHMVGAEVTELIQGFVVAMNLETTEE 451
                                         *************************************************************************** PP

                           TIGR01350 432 elaktihpHPtlsEaikeaalaalgkai 459
                                         el++t++pHPtlsE++ke++l+a+g+ +
  lcl|FitnessBrowser__Smeli:SMc01035 452 ELMHTVFPHPTLSEMMKESVLDAYGRVL 479
                                         ***********************99876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (461 nodes)
Target sequences:                          1  (481 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 8.05
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory