Align Aconitate-delta-isomerase 1; Itaconic acid/2-hydroxyparaconate biosynthesis cluster protein ADI1; EC 5.-.-.- (characterized)
to candidate SMc00497 SMc00497 tramsmembrane protein
Query= SwissProt::A0A0U2X0E4 (443 letters) >FitnessBrowser__Smeli:SMc00497 Length = 352 Score = 236 bits (603), Expect = 6e-67 Identities = 136/319 (42%), Positives = 192/319 (60%), Gaps = 8/319 (2%) Query: 11 RAGTSRGLYFLASDLPAEPSERDAALISIMGSGHPLQIDGMGGGNSLTSKVAIVSASTQR 70 R GTS+G YFLA DLPA+ ERD L+ IMGS P QIDG+GG + LTSKVA+V AS R Sbjct: 12 RGGTSKGAYFLADDLPADAGERDRLLLRIMGSPDPRQIDGIGGADPLTSKVAVVRASA-R 70 Query: 71 SEFDVDYLFCQVGITERFVDTAPNCGNLMSGVAAFAIERGLVQPHPSDTTCLVRIFNLNS 130 +FDVD+LF QV + + V + NCGN+++GV AFA+ERGLV+ +T +RI+ N+ Sbjct: 71 PDFDVDFLFLQVFVDQALVSDSQNCGNILAGVGAFAVERGLVEAAEGETA--IRIYMENT 128 Query: 131 RQASELVIPVYNGR-VHYDDIDDMHMQRPSARVGLRFLDTVGSCTGKLLPTGNASDWIDG 189 Q++ I NGR V+ D + P+A V L F D GS G LLPTG+A++ I+G Sbjct: 129 SQSAVARIRTANGRPVYAGDASIDGVPTPAAPVYLTFTDAAGSSCGALLPTGSAANEIEG 188 Query: 190 LKVSIIDSAVPVVFIRQHDVGITGSEAPATLNANTALLDRLERVRLEAGRRMGLGDVSGS 249 + ++ID+ +PVV +R D G+TG E+ L AN ++ R+ER+RL AG M LGDV Sbjct: 189 VACTLIDNGMPVVVMRAADFGLTGYESREELEANESVKARIERIRLAAGPLMNLGDVMKK 248 Query: 250 VVPKLSLIGPGTETTTFTARYFTPKACHNAHAVTGAICTAGAAYIDGSVVCEILSSRASA 309 VPK++L+ R F P H + V GA+ A A + S +S A Sbjct: 249 SVPKMTLVALPVNGGAIMTRSFIPHRVHASIGVFGALSVATACLLPNSPA----ASLAIL 304 Query: 310 CSASQRRISIEHPSGVLEV 328 ++ +++EHP+G +E+ Sbjct: 305 PEGEEKTVAVEHPTGRMEI 323 Lambda K H 0.318 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 352 Length adjustment: 31 Effective length of query: 412 Effective length of database: 321 Effective search space: 132252 Effective search space used: 132252 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory