Align threonine ammonia-lyase (EC 4.3.1.19) (characterized)
to candidate SMc00936 SMc00936 threonine dehydratase
Query= BRENDA::Q04513 (436 letters) >FitnessBrowser__Smeli:SMc00936 Length = 415 Score = 317 bits (811), Expect = 6e-91 Identities = 172/399 (43%), Positives = 240/399 (60%), Gaps = 6/399 (1%) Query: 25 DIQTAQARISSVIAPTPLQYCPRLSEETGAEIYLKREDLQDVRSYKIRGALNSGAQ-LTQ 83 D++ A A + + PTPLQ LS GA ++LKREDL VRSYKIRGA N + L Sbjct: 4 DVEKAAAAMREIFPPTPLQLNEHLSARCGATVFLKREDLSPVRSYKIRGAFNFFRKSLGS 63 Query: 84 EQRDAGIVAASAGNHAQGVAYVCKSLGVQGRIYVPVQTPKQKRDRIMVHGGEFVSLVVTG 143 V ASAGNHAQG A+VC+ GV G +++PV TP+QK D+ + G EF+++ + G Sbjct: 64 GAAGKTFVCASAGNHAQGFAFVCRHFGVPGVVFMPVTTPQQKIDKTRMFGAEFITIRLVG 123 Query: 144 NNFDEASAAAHEDAERTGATLIEPFDARNTVIGQGTVAAEILSQLTSMGKSADHVMVPVG 203 + FD+ AA E E G ++ PFD + + GQ TVAAEI QL + G AD V++PVG Sbjct: 124 DIFDQCYKAAREHVEAIGGVMVPPFDHDDIIEGQATVAAEIAEQLPA-GPVADLVVLPVG 182 Query: 204 GGGLLAGVVSYMADMAPRTAIVGIEPAGAASMQAALHNGGPITLETVDPFVDGAAVKRVG 263 GGGL AGV Y+ D + EP GA S + +L GG +TL+ VD FVDGAAV R+G Sbjct: 183 GGGLAAGVTGYLGDSLSADRFLFCEPEGAPSFRRSLELGGVVTLDQVDNFVDGAAVARIG 242 Query: 264 DLNYTIVEKNQGRVHMMSATEGAVCTEMLDLYQNEGIIAEPAGALSIAGLKEM--SFAPG 321 DLN+ + + +M E A+C + ++ EG++ EPAGAL+I L+ + G Sbjct: 243 DLNFAALRRFSPE-QVMLLPENAICLTITEMLNVEGVVLEPAGALAITALEALGRDSLEG 301 Query: 322 SVVVCIISGGNNDVLRYAEIAERSLVHRGLKHYFLVNFPQKPGQLRHFLEDILGPDDDIT 381 +VV ++SGGN D R ++ ER++ H GLK YF++ Q+PG LR FL +LG +DDI Sbjct: 302 KIVVAVVSGGNFDFERLPDVKERAMRHAGLKKYFILRMAQRPGALRDFL-GLLGEEDDIA 360 Query: 382 LFEYLKRNNRETGTALVGIHLSEASGLDSLLERMEESAI 420 FEYLK++ R G+ L+GI A L +R + + + Sbjct: 361 RFEYLKKSARNFGSVLIGIETKHAENFPVLKQRFDAAGL 399 Lambda K H 0.316 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 17 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 415 Length adjustment: 32 Effective length of query: 404 Effective length of database: 383 Effective search space: 154732 Effective search space used: 154732 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate SMc00936 SMc00936 (threonine dehydratase)
to HMM TIGR02079 (ilvA: threonine dehydratase (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02079.hmm # target sequence database: /tmp/gapView.17502.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02079 [M=410] Accession: TIGR02079 Description: THD1: threonine dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-178 579.2 0.0 2.4e-178 579.0 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc00936 SMc00936 threonine dehydratase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc00936 SMc00936 threonine dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 579.0 0.0 2.4e-178 2.4e-178 1 410 [] 3 415 .] 3 415 .] 0.99 Alignments for each domain: == domain 1 score: 579.0 bits; conditional E-value: 2.4e-178 TIGR02079 1 ediekakkrlkevvketPlqknerlsekykaeiylkredlqevrsyklrGaynkl.kqlsdeelekgvvcasaGn 74 +d+eka+ ++e++ +tPlq ne+ls++ +a+++lkredl+ vrsyk+rGa+n++ k+l + k++vcasaGn lcl|FitnessBrowser__Smeli:SMc00936 3 QDVEKAAAAMREIFPPTPLQLNEHLSARCGATVFLKREDLSPVRSYKIRGAFNFFrKSLGSGAAGKTFVCASAGN 77 69****************************************************9899***************** PP TIGR02079 75 haqGvayacrklgvkgtvfmPvttPkqkvdkvklfGgefievilvGdtfdeaaaaakkavekegktlipPfddkd 149 haqG+a+ cr++gv g+vfmPvttP+qk+dk+++fG efi ++lvGd+fd+++ aa+++ve+ g ++pPfd++d lcl|FitnessBrowser__Smeli:SMc00936 78 HAQGFAFVCRHFGVPGVVFMPVTTPQQKIDKTRMFGAEFITIRLVGDIFDQCYKAAREHVEAIGGVMVPPFDHDD 152 *************************************************************************** PP TIGR02079 150 iieGqgtvaveileqleee.kidlvlvpvGGGGlisGvtsylkekskktkiigvePeGapslkaslkagevvtld 223 iieGq+tva+ei eql+ + +dlv++pvGGGGl++Gvt+yl + + ++++++ePeGaps++ sl+ g vvtld lcl|FitnessBrowser__Smeli:SMc00936 153 IIEGQATVAAEIAEQLPAGpVADLVVLPVGGGGLAAGVTGYLGDSLSADRFLFCEPEGAPSFRRSLELGGVVTLD 227 *****************99899***************************************************** PP TIGR02079 224 kidkfvdGaavkrvGdlnfkalkkvvd.evtlveegavcstildlynkegivaePaGalsiaaleels.eeikgk 296 ++d+fvdGaav+r+Gdlnf+al+++ +v+l++e+a+c ti +++n eg+v+ePaGal+i+ale l + ++gk lcl|FitnessBrowser__Smeli:SMc00936 228 QVDNFVDGAAVARIGDLNFAALRRFSPeQVMLLPENAICLTITEMLNVEGVVLEPAGALAITALEALGrDSLEGK 302 ************************98769**************************************8799**** PP TIGR02079 297 tvvcvvsGgnndierleeikersllyeGlkhyflvkfpqraGalreflndvlGPndditkfeyvkksnretGevl 371 vv+vvsGgn+d+erl+++ker++++ Glk+yf+++++qr+Galr+fl +lG +ddi++fey+kks+r++G+vl lcl|FitnessBrowser__Smeli:SMc00936 303 IVVAVVSGGNFDFERLPDVKERAMRHAGLKKYFILRMAQRPGALRDFLG-LLGEEDDIARFEYLKKSARNFGSVL 376 ************************************************9.************************* PP TIGR02079 372 iGielsdkedfeGllerlkaadieyeainenetlyellv 410 iGie++++e+f l +r++aa+++y++i+ene+l ++++ lcl|FitnessBrowser__Smeli:SMc00936 377 IGIETKHAENFPVLKQRFDAAGLRYQDITENEMLANFVI 415 **********************************99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (410 nodes) Target sequences: 1 (415 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.88 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory