Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate SMc01214 SMc01214 zinc-containing alcohol dehydrogenase
Query= BRENDA::Q5JI69 (350 letters) >FitnessBrowser__Smeli:SMc01214 Length = 347 Score = 169 bits (429), Expect = 8e-47 Identities = 107/331 (32%), Positives = 174/331 (52%), Gaps = 13/331 (3%) Query: 22 VDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPQIMGHEVAGEVVEVGPGVE 81 V +P+PGP ++L+KV A ICGTD H+ + PP +GHE G VVE G V Sbjct: 17 VGIPEPGPDDLLVKVEACGICGTDRHLLH----GEFPSTPPVTLGHEFCGIVVEAGSAVR 72 Query: 82 DLQVGDYISVETHIVCGKCYACKHNRYHVCQNTKIFGVDMDGVFAHYAIVPAKNAWKNPK 141 D+ G I+ + +I CG+C C+ R ++C+N + G+ DG FA Y +VP K A++ P Sbjct: 73 DIAPGARITGDPNISCGRCPQCQAGRVNLCRNLRAIGIHRDGGFAEYVLVPRKQAFEIPL 132 Query: 142 DMPPEYAALQEPLGNAVDTV-LAGPIAGRSTLITGAGPLGLLGIAVAKASGAYPVIVSEP 200 + P + A EPL + V L+G AG + I G G +GLL + +A+ +GA VI+S Sbjct: 133 TLDPVHGAFCEPLACCLHGVDLSGIKAGSTVAILGGGVIGLLTVQLARLAGATTVILSTR 192 Query: 201 SEFRRKLAKKVGADYVVNPFEEDPVKFV---MDITDGAGVEVFLEFSGAPKALEQGLKAV 257 +R+LA++VGA V+P D V+ + + + G GV+V +E +G + ++Q + Sbjct: 193 QATKRRLAEEVGATATVDPSAGDVVEAIAGPVGLVPG-GVDVVIECAGVAETVKQSTRLA 251 Query: 258 TPGGRVSLLGLFPREVTIDFNNL-IIFKALEVHGITGRHLWETWYTVSSLIQSGKLNLDP 316 GG V +LG+ P+ ++ I+F+ L V G + L+ +G + +D Sbjct: 252 KAGGTVVILGVLPQGEKVEIEPFDILFRELRVLGSFINPF--VHRRAADLVATGAIEIDR 309 Query: 317 IITHKYKGFDKFEEAFELMRAGKTGKVVFFP 347 +I+ + D+ + A KV+ P Sbjct: 310 MISRRI-SLDEAPDVISNPAAAGEVKVLVIP 339 Lambda K H 0.319 0.139 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 347 Length adjustment: 29 Effective length of query: 321 Effective length of database: 318 Effective search space: 102078 Effective search space used: 102078 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory